KEGG   Magnaporthe oryzae: MGG_08424Help
Entry
MGG_08424         CDS       T01027                                 

Definition
(RefSeq) endo-1,4-beta-xylanase I
  KO
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MGG_08424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 231 aa AA seqDB search
MVSFTTILVAATAALVAANPVPPSIDEMREIYVKSRDLHARGGTPSSTGTHDGFYYSWWT
DNGAQATYTNNAGGSYSITWSGNGNLVGGKGWNPGSARNVTYSANYRPNGNSYLSVYGWT
RNPLVEYYVVENFGTYDPSSQASRKGTINVDGATYQVAQSTRTNQPSIDGTRTFQQYWSV
RQQKRSSGTVDMKKHFDAWASMGMKLGTHDYQIVATEGYFSSGSSTVTIQR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtctccttcaccaccatcctcgtcgccgccacggccgcccttgtcgcggccaacccg
gtcccgccgtccatcgacgagatgcgcgagatttacgtcaagtcgcgcgacctccacgcc
cggggcggcacccccagctccacgggcacgcacgacggcttctactattcctggtggacc
gacaacggggcccaggccacctacaccaacaacgctggagggtcctacagcatcacctgg
tccggcaacggcaacctcgtcggcggcaaggggtggaacccggggagtgctcgcaatgtc
acctactctgccaactaccgccccaacggcaactcgtacctgtccgtctacgggtggacg
cgcaacccgctcgtcgagtactacgtggtcgagaactttggcacgtacgacccgtcctcg
caggcctcgcgcaagggcaccatcaacgtcgacggcgccacgtaccaggtcgcccagtcg
acgcgcaccaaccagccgtccatcgacggcacccgcacctttcagcagtactggtccgtc
cgccagcagaagcggagctccggcaccgtcgacatgaagaagcactttgacgcctgggcc
tccatgggcatgaagctcggcacccacgactaccagatcgtcgccaccgagggctacttt
agcagcggctcttccaccgtcaccatccagcggtga

DBGET integrated database retrieval system