KEGG   Magnaporthe oryzae: MGG_08455Help
Entry
MGG_08455         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGG_08455
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MGG_08455
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     MGG_08455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 386 aa AA seqDB search
MHVDIPSVLAGFACLATAVSGSALPPASSAEKLLTSLQKQAVAALKERGAGANGCTVENA
AVRRDWAKLSKKERKEYIRAVQCLRSAPAKGDPSFAPGAKTRFDDFVAVHINNTLSIHGT
GNFLTWHRYVTWAYENALREECGYKGTQPYWNWFHRADDMTKSPVFDGSDTSLGGNGEFK
AHNGTLGGAGAIFIPPGVGGGCVTKGPFVDFPANIGPVRPGMDGMVPSPTGPLGPNPRCL
TRDLSNVVSRTYFTHANLHNLTLGAASGSIELMQNEFQGRFADGFLGMHGAGHFGVGGDA
SDLFSSITDPSFYMHHSMVDFVYWIWQALHPDLAGDIAGSITVNNSPPSREARKDDLLPM
GVTTQDRPIGDLLDTLGGTPGCYIFE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcgacatccccagcgtcctagcgggatttgcctgccttgcaaccgcggtgtcc
gggtccgctctgcctcccgcgtcttcggcagagaagctcctaacctcgttacagaagcag
gccgtcgcggctttgaaggagaggggagcaggtgcgaacggatgcacagttgaaaatgcc
gctgttaggcgtgattgggcaaagttgagcaagaaggagcggaaggagtacatccgggca
gtgcagtgcctccgcagcgcgccggccaaaggagacccttcctttgcgcccggggccaag
acgcgcttcgacgactttgtggcggtccacatcaacaacaccctgtccatccacggcacg
ggcaactttttgacgtggcatcggtacgtcacctgggcgtacgagaatgcgctccgcgag
gagtgcggctacaaggggacccagccctactggaactggttccaccgcgccgacgacatg
accaagtcgcccgtctttgacggctccgacacctcgctgggcggcaacggcgagttcaag
gcccacaacggcaccctcggcggcgccggcgccatcttcatccctcccggagtgggtggc
ggctgcgtgaccaagggcccgtttgtcgacttccccgccaacatcggccccgtccgcccg
gggatggacggcatggtcccctcgcccacgggaccgctggggccgaacccgcgctgcctg
acgcgggacctgagcaacgtggtctcgcgcacctacttcacccacgcgaacctgcacaac
ctcacgctcggcgccgcgtcgggctccatcgagctgatgcagaacgagttccagggccgg
ttcgccgacgggttcctgggcatgcacggcgccggccactttggcgtggggggcgacgcg
agcgacctcttctcgtccatcaccgacccctccttctacatgcaccactccatggtcgac
tttgtctactggatctggcaggctctgcacccggacctggccggcgacattgccggcagc
atcacggtgaacaacagcccgcccagcagggaggcgaggaaggacgacctgctgcccatg
ggcgtgaccacccaggacaggccgattggcgatcttttggatacgctgggtggcacgccg
ggatgctacatttttgagtag

DBGET integrated database retrieval system