KEGG   Magnaporthe oryzae: MGG_08842Help
Entry
MGG_08842         CDS       T01027                                 

Definition
pyruvate dehydrogenase complex protein X component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mgr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgr00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 445 aa AA seqDB search
MASLASLGRLSGRAGQVGGRRLAQSTVARRDFRTSTAALAAQNFTMPALSPTMTEGNIAT
WRVKEGDKFQAGDVLLEIETDKATMDVEAQEEGVVMKILQGDGAKAVKVGARIAVLAEEG
DDVSTLEIPAEDQTGAKDSAKEQLSQGSSTYGGGSAPPPNDSVPDQPTHSAAKANGGGKA
PKQTYPLLPSVAHLVKEKGLDEAALAEMTPTGPNGRLLKGDVLAYLGAINQKTPVSISEM
FERLSHLDLSNIKIVKSTPPPAKEETKAAAAAETPAPRVQQVQVSLPVSLEAAFRAHRKV
YKNLAVNLPLATFIERAADIANEGLPASARKPSADDLFNDLLGLPQAGHSATRGRYFPMI
SSPTATVAQPAFSGSRQQTDIIDILSGTATKARKPVAQPVAEFDVTDADVPLFSLNVPKT
EEKRARVFLERIKVVLENEPARLLL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcttcattagcttcactcggccgcctgtccggcagggcgggacaagtcggcggacgg
aggctcgcgcaatctacagtcgcgcgcagagactttaggacctcgacagctgccctggca
gctcagaacttcaccatgccagccctttcgccgaccatgaccgagggaaacatcgcgacg
tggcgtgtcaaggagggcgacaagttccaagccggtgatgttctgctcgagatcgagacc
gacaaggccaccatggacgtcgaggcacaggaggagggcgtcgtcatgaagatcctgcag
ggtgacggtgcaaaggcagtcaaggtgggcgcccgcatcgcagtcctcgccgaggagggc
gatgacgtctcgaccctcgagatccccgccgaggaccagactggtgccaaggacagcgca
aaggaacaattgtcccagggctcatcgacctacggcggcggctcggctcctccgcccaac
gactcggtgccagaccagcctacccactcagcggccaaggcgaacggtggcggcaaggca
cccaaacagacataccccctgctgccgtcagtcgctcacctcgtcaaggagaagggcttg
gacgaggcggccctggcggagatgacgccgacgggccccaacggccgcctgctcaagggt
gacgtcctggcctaccttggcgccatcaaccagaagacgcccgtgtccatctccgagatg
tttgagaggctttcacatctggacctcagcaatatcaagatagtaaaatcgaccccgccg
cccgccaaggaggaaacgaaggccgccgccgccgccgagactcccgctcccagggtacag
caggtccaggtcagccttcctgtgtcactcgaggctgcgttccgcgctcaccgcaaggtc
tacaagaacctggccgtcaatctgcctctggccaccttcatcgagcgtgccgcagacatt
gccaacgaaggcctccccgcatcggcccgcaagccttcggccgacgacctcttcaacgac
cttctcggtctccctcaggcggggcacagcgccactcgcggccgctacttccctatgatc
tcttcccctaccgctactgtcgcccagcccgccttctcgggcagccgccagcagaccgac
atcatcgacatcctgtccggcacagccaccaaggccaggaagccggttgcccagcctgtg
gccgagttcgatgttaccgatgccgacgtgcccctgttcagcctcaacgtgccgaaaact
gaggagaagcgcgccagggttttcctcgagagaatcaaggttgtgttggagaacgagccg
gcaaggctattgttgtaa

DBGET integrated database retrieval system