KEGG   Magnaporthe oryzae: MGG_08911Help
Entry
MGG_08911         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
mgr  Magnaporthe oryzae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGG_08911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1666 aa AA seqDB search
MSEAYLLETLQSFYGDLIAIGEGRLNGPSLEGDELTALLENFKNFLEEPPKRDASRKQLE
SGKISVGDVEYSINKEFQEYSIQLADEVNLDEVEAAKLLLEAQDSQILLGRSLVECALIR
FHQRRKYLLDCIRLCIELANDDENESIKAVFEEIVARYVFDLPLPGAPAAAVPKEKKVVP
RCMAAMAKIKDWLEKLANKIMLARMHSGTAPPEIETIEFCRLSLVQQHENLAVILCAAVE
QRHAERTNFEEFIQLLKKADKYDHLLVHLFPVIGAYIRLYGSTEGWGDLVIARSLNQKIV
NDETSWSLPFLYAAVKVWWIAEYSGFYVEGPVSDPSIDIDKEDKERNKQFTDALKEGAFD
FMLSLAGDVAAPEWQDPSRIGIRQWLQRKSPQLMTDSTPFSDYFHTCLMNQLEDFVDAFI
SNLPDVLRKLRTEEDEQRQLSQHHEQDLDLERFLVIISYVFERRPDAADVFWSDSESNLA
GFMQWASRRASTPLVCAFCEMLQSITENEQYALAAHQFLLEDSNAGGKMRRSQSLTWAQI
FKELHYFTKKIRGEISSPQQIHEYRTQKPGEDLAETEPESAMLLECYLRLIARLGSQSTA
AREFLLRNQDFPLVDVILQLNSCHIPPRLRACGFYAIAALVRRKEQDDSNTMWLCIDAFV
SGGFQAASNSRGLIKGQSHSSAGVVDRVLDELSNGFEEPSAFINLINALVAPADQASLLR
DALPFPENLGSSLRMPGIEPYVDFVVGHVFSLKSKELQDVSQLRVLRVSCLEFILLCLNT
FNEDLIILGNQTNVSVDLIIATSDLATYVRLHPFARVMEWMFNGQVVDAIFETIHQQSSD
IGSVSPDSPLILGIIRAVEVVSKVLELQDTYVDLVRQVIKQHTGQRHRHVPHASYASFEE
GFAHHLEVVADLGRYCGLGHPELTMVCLKLLARISTSSKLISAWNTEPGRQSHRNKAVVA
LEKDGEADSISGSLIAELIVPLDLAREADSPNYLIKTYILDFLYACLRASPDQPTIAHLL
LGFKCGVSHLKVEPRGQFEERTSLFHNLLRVLLETPFGDEELGMRTWLVALKRKVMGILQ
ILWSSPLSSAIVLEELRSNDVLFHILLREESIQPDLMWDGVSMEERGFLLSDAAVGFSEF
LATRQLTFDYLAIELCSVTQRRLPSLKRRIYDALNGQVTTANSDSPQSIPTIFDLYDFMP
ADGQWEIPLPEFTHFKGEEFSMCLEGAHDSVLMYNMERVKQVIALKRRQDAQNGQIATAA
DLASVDREQVILEEYLVYHNRQAAVSSERRKVLKAWVNLLMVMFEASDHQGSAKVAFLLQ
ALQTILPTLESFGSERPGEAFELAKLAKVLLFKLDIAAPDAEDKDAHTVGNLISEKLFQL
FEVCLYAIGRRTGSAELRSTYYAICYRYLIGIIDDGRDFVPGRRKAIKAVQVYGERLLTI
VCDDAFGGDATCQTSALILLGALTNLGRREDDGQVVEALNRLNFIGVLVDSLKTILDDVT
AARKAGNSDQQESYSHAKLALLLQLCQTRDGAKYVLQANLLRAIEVSGLFAADPELQIDR
SDTKALADHYDLLIRVMRVIGAAILSRGAHNVPQGRRFLTEHRMLVMHVLKRSAGIAAVD
QKLEALVVGLADSFMVLITATEFLEFEDTQGRGPQQQKKTGPVLFH
NT seq 5001 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagcctatcttttagagacactgcagtccttctatggcgatctaatcgcaata
ggcgaggggcgcctcaatggcccgtctctggagggagacgagctgacggctctcctcgaa
aacttcaagaactttcttgaggagccaccaaagcgagacgctagccgaaaacaacttgag
tccggcaagattagcgtgggagacgtagaatactcgatcaacaaggagttccaggaatat
agcatacaactcgcagacgaggtaaacctggatgaggtcgaggcggccaagctgctcctc
gaggcacaagatagccagatcctcctgggaaggtcgctagtcgagtgcgcgctcattcgg
ttccaccaacgacgaaaatacctcctagattgtatacgactatgtatcgagcttgcgaat
gacgacgagaacgaatcgatcaaggcggtcttcgaagaaattgttgcacgatatgttttt
gacctgccattgccaggtgctccggccgcggcggttccgaaggaaaagaaagtagtgcca
cggtgtatggcagcaatggccaagatcaaagactggctcgaaaaactggccaacaagatc
atgctggcaagaatgcacagcggcacggctcctcctgagatcgagaccatcgagttttgc
cgcttgagtctagtgcagcaacacgagaacttggccgtcatcctatgcgctgcggttgag
caacgtcatgcagaacgcacaaactttgaagagttcatccaactgctgaagaaggccgat
aaatacgaccacctcttagtgcatcttttccccgtcattggagcctatattcgtctgtat
ggatcgactgagggctggggggatctggttattgccaggtctttgaaccaaaaaattgtc
aacgacgagacgtcttggtccttgccgtttctgtatgccgctgttaaggtctggtggatt
gcagagtacagcggcttctacgtcgagggtcctgtttcggatcccagcattgacattgac
aaagaggataaggagagaaataagcagttcaccgacgctctcaaggagggagcattcgac
ttcatgttgtcacttgcaggggatgttgctgcccctgaatggcaagacccctctcgtatt
ggaatcaggcaatggctccagcgaaagtcaccacaactgatgactgattcaacgccattc
tccgactacttccacacgtgcttgatgaaccagcttgaagattttgtggatgcttttata
tcaaatcttcccgatgttcttcggaaacttaggaccgaggaggacgaacaacggcagctt
agccagcaccatgaacaagacttggatctggaaagattcctggtcatcatctcttacgtc
tttgaaagacggcccgacgcagctgacgtgttctggtcggactctgaaagcaacttggca
ggtttcatgcagtgggcatccaggagagcatccacgccgctcgtgtgtgctttctgcgag
atgctgcagtccatcactgagaatgaacagtacgcacttgctgctcaccagttcttgttg
gaggacagcaatgccggagggaaaatgagaagatcacagtccttgacatgggctcagatt
ttcaaagagttgcactacttcaccaagaaaattcgtggtgaaatctctagcccacagcaa
attcacgaataccgaacgcaaaagccaggcgaggacctagcagaaacggaaccggagtcg
gctatgctgctggagtgctatctccgattgatcgcccgacttggaagtcagagcacagcg
gcaagggagttcctactcaggaaccaagacttccccttggtagatgtgattctgcagctg
aacagctgccacatacctcctaggctgcgtgcctgtggcttctatgccattgcggcacta
gtcaggcgcaaagaacaagacgacagcaataccatgtggctttgcatagacgcctttgtt
agtggcggctttcaagccgcgagcaactcccgtggattgattaagggacaaagccacagc
tcagccggcgttgttgatagggtattggacgagctgagcaacggtttcgaggaaccaagt
gcttttatcaacctgatcaacgctttagtcgcgccagcagatcaagcaagtctcctgcga
gatgcccttcctttccccgagaaccttgggtctagcttacgaatgccggggattgagcca
tacgttgactttgttgtgggacatgtcttcagcctcaagtcaaaagagctccaggatgtt
tcgcagctgagagttctgcgagtgagctgtttggagtttatcttgctgtgcctaaacacg
ttcaacgaagatcttatcattcttggtaatcagaccaatgtctctgtggacttgatcatt
gccacatcagacctggccacatatgtccgccttcacccattcgctcgggtgatggaatgg
atgttcaacggccaggttgtagatgccatatttgaaacgatacaccaacagtccagcgat
atcggaagcgtttcgcccgattcgcccttgatattgggcattatacgagctgttgaggtg
gtgtcgaaagttttggagcttcaggacacatatgttgatcttgtgcggcaagtcataaaa
cagcacacaggacaacgccatagacatgtgcctcacgcttcctacgcctccttcgaagaa
gggtttgctcatcacctcgaggtcgtcgcagatctcggccgatattgcggcctcggtcac
ccagagctgaccatggtctgcttaaagcttctggcacggatttccacttcatcgaaactg
atatcggcgtggaacaccgagccaggtagacagtcccaccgcaacaaggcggtagtggct
ctagaaaaagatggggaagcggattctatttccggatccctcattgccgagcttatcgtg
ccccttgacctggctcgagaggctgactctccaaactacctaatcaagacttacattcta
gacttcctctacgcatgtttacgagcatctccagaccaaccaactatcgcccatcttcta
ctcggcttcaagtgcggcgtgagccatttgaaagtcgagcccagaggccagttcgaggaa
aggacgtcgctatttcacaatcttctcagggtattgctggagactccttttggagacgag
gagctaggaatgaggacatggcttgtggcattaaagcgcaaagttatggggatactgcag
attctttggagttctcctctgtcctcggccattgtcttggaagaactccggagcaacgac
gttctattccatattctgctccgcgaggagtcaatacagcctgatctgatgtgggatgga
gtgagcatggaggaacgcggattcctactctctgacgcagccgtgggtttttcggagttc
ctggctacgaggcaacttaccttcgattatctggccatcgagttatgcagcgtcacccag
aggcgcctccccagcttgaaacgccgtatctatgacgcccttaacggacaggtcactact
gccaattcggacagccctcaatccatacccaccatcttcgatttgtacgattttatgcct
gcggacgggcaatgggagatccctctacctgagttcacccatttcaaaggcgaagaattc
agtatgtgcctggaaggagcacatgactctgtgctcatgtacaacatggagcgggtaaaa
caggtgattgcattgaagaggaggcaggatgctcaaaatggtcagatagctacggctgcc
gacctcgcttccgtggaccgggagcaggttattcttgaggaatacttggtctaccacaac
cgccaagcagcagtcagttctgagcgacggaaagtgctcaaagcctgggttaatctgctc
atggtgatgttcgaggcgagcgatcaccagggctcagcgaaggttgctttccttttacaa
gcattgcagacgatattaccaactcttgagtctttcggatccgaacgtccgggtgaggca
tttgagctggcgaaactggcaaaagttctcctcttcaagctcgacatagccgctccagac
gcagaggacaaggacgcacataccgtgggcaacctcatcagcgagaagctcttccagttg
tttgaggtttgcctgtacgccataggtaggcgaacgggcagtgcggaacttcgatccacg
tactatgccatctgctaccggtatctgataggtatcattgacgatggaagagatttcgtg
cctggccgcaggaaagcgatcaaggctgttcaggtctacggcgagcgcctgttgaccatc
gtctgcgacgatgcatttggcggcgatgcaacgtgccaaacttctgcgttgatcttgcta
ggcgctttgacgaacctgggtcgacgagaggacgacggtcaagtggtggaggctctcaat
cgcctgaactttattggcgtcctcgttgactctttgaagacaatcctcgatgatgtgact
gcggcccgtaaagcaggaaactcggaccagcaagaatcttactcgcacgcaaaattggcg
cttctccttcagctctgccaaacccgcgatggagcaaagtatgtgctgcaggctaacctc
ctgcgcgcaattgaggtctctgggctttttgcggcagacccagagctccagattgatcgg
agcgacactaaagccttggcggaccattatgacctcctaataagggtgatgcgtgtcatc
ggtgcggcaatactgagtcgcggcgcgcacaacgtcccgcaaggtcgccggttcctgacc
gagcaccgcatgcttgtaatgcacgtcctcaagcgatccgctggcatcgcagccgtcgac
cagaagctggaggcgctagttgttggactcgcggattccttcatggtgctgattactgcc
acagagtttttggagtttgaggatactcaagggcggggtccgcaacagcaaaagaagact
ggcccagtcctgtttcattga

DBGET integrated database retrieval system