KEGG   Magnaporthe oryzae: MGG_08923Help
Entry
MGG_08923         CDS       T01027                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MGG_08923
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGG_08923
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MGG_08923
Enzymes [BR:mgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MGG_08923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 549 aa AA seqDB search
MENGAATNGASEKSHSPSQTYLSTRGDDYGLSFETVVLKGLAADGGLFLPEEVPAATEWQ
SWKDLPYTELAVKVLSLYISPAEVPTEDLRALVERSYSTFRSKEVVPLVKLEDNLHLLEL
FHGPSYSFKDCALQFLGNLFEYFLTRKNKGKEGKDRHHLTVVGATSGDTGSAAIYGLRNK
KDVSVFILHPKGRVSPIQEAQMTTVLDQNVHNLAVTGTFDDCQDIVKAMFNDPDSNATLK
LGAVNSINWSRILAQIVYYFHSYFSLARASPETFKVGDKVRFVTPTGNFGNILAGYFAQK
MGLPVDKLVVATNENDILDRFWKTGRYEKKPASPEEAAGGLPQDGVKAHEEGCKETLSPA
MDILVSSNFERTLWFLAKEFAATAGLNDEFNKKQAGQEVVAWYKSLKATGGFGPVHPEIM
DNGRQVFESERVSDTQTLEMIAEMYKATKYVLDPHSAVGVAGAKRSMSRASNVPHIALST
AHPAKFSGAVELALKDQKEFDFTKQVLPEDFVGLAEKEKRVTEVAANWQEVREIVKKQVE
EDLKAESSA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggtgctgcaaccaacggggcgtcggagaagtcgcactctccttcacagacc
tacctctccacaaggggagacgattatgggctctcattcgagaccgtcgtcctcaaaggt
cttgcggctgacgggggtcttttcctgcccgaggaagtgcccgcggcaaccgagtggcaa
agctggaaagacctgccctacaccgagcttgccgtcaaggttctcagcttgtacatctcc
cccgccgaggtgccgacggaagacctcagggcgctcgtcgagcgcagctactcgaccttc
cgatccaaggaggttgtgccgctggtgaagctggaggacaaccttcacctgctggagcta
ttccacggccccagctactcgttcaaggactgcgcgctgcaattccttggtaacctcttc
gagtactttttgactcgcaagaacaagggaaaggagggcaaagacaggcaccacctcact
gtggtcggcgcaacaagtggtgataccggttcggcggccatctatggtcttcgcaacaag
aaggatgtttccgtcttcatcctgcaccccaagggtcgtgtaagccccatccaggaggcc
cagatgaccacggtgctcgaccaaaatgttcacaaccttgccgtgaccggcacctttgac
gattgccaagatatcgtcaaggccatgttcaacgacccagattcgaatgcgacactgaag
cttggtgctgtcaactcgatcaactggtccaggatattggcccagattgtttactacttc
cactcgtacttttctctggccagggcgtcaccagagacgttcaaggtcggcgacaaagtc
cgctttgtcacccccaccgggaactttggtaacatcctggctggatactttgcacaaaag
atgggcttgcctgtcgacaagttggtcgttgcgacaaatgagaacgacattcttgacagg
ttttggaagacgggccgctacgaaaagaagcctgcaagccccgaggaagccgcaggcggt
ctgcctcaagatggcgtaaaggctcacgaggagggctgcaaggagaccctgagcccggcg
atggacattttggtgtcgagcaactttgagcgaacactgtggtttcttgccaaggagttc
gctgctacggctggcctcaatgacgagttcaacaagaagcaagccggccaggaagttgtg
gcatggtacaagtccctcaaggctaccggaggcttcggtccggtccaccctgaaatcatg
gacaatggccgccaggtctttgaaagcgagcgcgtgagcgacacccagaccctcgagatg
atcgcggagatgtacaaagccacaaagtacgttctcgacccgcactctgccgtcggtgtt
gcgggggccaagaggtcaatgtcgagggcctccaacgtcccgcacatcgcgctgtccacg
gcccacccagccaagttctctggcgccgttgagcttgcgctcaaggaccagaaggagttc
gactttacaaagcaggtcctgccagaggactttgttggactagcagagaaggaaaagagg
gtgactgaggtggccgcgaactggcaggaagtgagggagattgtcaagaagcaggtcgag
gaagacttgaaggctgaaagtagtgcataa

DBGET integrated database retrieval system