KEGG   Magnaporthe oryzae: MGG_09458Help
Entry
MGG_09458         CDS       T01027                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mgr  Magnaporthe oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 310 aa AA seqDB search
MGRADDRTSPAASSSSSSGNSGTKRSRKHRDDEPAAGATEHTKKKHKKRKSDHGVNGVIK
SSQRRLSLSNAARDPRDEPPPKPKKKPEAPTRSPSPLIDFDGLSRPSVGTRARLEETPEQ
AAERLERMRGAVRTLLECVGEDPDRQGLLATPDRYAKALLFLTKGYQENIKDIVNNAIFH
EGHNEMVIVKDIEIFSMCEHHLVPFTGKMHIGYIPANSVIGLSKLPRIAELFARRLQIQE
RLTKEVANAIFEVLKPQGVAVVMESSHLCMVTRGVQKTTATTITSCVLGCFEGRERTRNE
FLSLIGVNRH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggggagggccgacgatcggacctcaccggctgcgagctcgagttcgagctcgggtaac
agcggtactaaacgaagccgcaagcatcgagacgacgagcccgccgccggtgcaacagag
cacacaaaaaagaaacacaagaagcgcaagtcagaccacggcgtcaatggcgtcatcaaa
tcctcgcagaggaggttgagcctgagcaacgccgcccgcgaccctcgcgacgagccccca
ccgaagcccaaaaagaagcccgaggccccgacgaggtcaccaagtcccctcatagacttt
gacggcttgagcaggccaagcgtcggaacccgcgcaagactggaggagaccccggagcag
gcggcggagcggctggaacgcatgcgcggcgccgtcaggactctgctggaatgtgtcggt
gaggatccagatcggcagggcttgctggccacgcccgacaggtacgccaaggctctgctc
ttcctcaccaagggctaccaagagaacataaaagacattgtgaacaacgccatattccac
gaggggcacaacgagatggtcattgtcaaggacattgagattttcagcatgtgcgagcat
catctggtgccgttcaccggcaagatgcacataggttatattcctgccaactctgttatt
ggactttcaaagctgccccgcatcgcggagctcttcgcccgccgcctgcagattcaagag
cgtctgaccaaggaggtggcgaatgcaatctttgaggtgctcaagcctcagggtgttgca
gtggtgatggagtccagccatttgtgcatggtgacgcgcggtgtgcaaaagaccacggct
acaaccatcaccagctgcgtcctgggctgcttcgaaggccgggagaggactcgtaatgag
ttcctgagcctgattggtgtcaacaggcactga

DBGET integrated database retrieval system