KEGG   Magnaporthe oryzae: MGG_09458Help
Entry
MGG_09458         CDS       T01027                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mgr  Magnaporthe oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGG_09458
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MGG_09458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 310 aa AA seqDB search
MGRADDRTSPAASSSSSSGNSGTKRSRKHRDDEPAAGATEHTKKKHKKRKSDHGVNGVIK
SSQRRLSLSNAARDPRDEPPPKPKKKPEAPTRSPSPLIDFDGLSRPSVGTRARLEETPEQ
AAERLERMRGAVRTLLECVGEDPDRQGLLATPDRYAKALLFLTKGYQENIKDIVNNAIFH
EGHNEMVIVKDIEIFSMCEHHLVPFTGKMHIGYIPANSVIGLSKLPRIAELFARRLQIQE
RLTKEVANAIFEVLKPQGVAVVMESSHLCMVTRGVQKTTATTITSCVLGCFEGRERTRNE
FLSLIGVNRH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggggagggccgacgatcggacctcaccggctgcgagctcgagttcgagctcgggtaac
agcggtactaaacgaagccgcaagcatcgagacgacgagcccgccgccggtgcaacagag
cacacaaaaaagaaacacaagaagcgcaagtcagaccacggcgtcaatggcgtcatcaaa
tcctcgcagaggaggttgagcctgagcaacgccgcccgcgaccctcgcgacgagccccca
ccgaagcccaaaaagaagcccgaggccccgacgaggtcaccaagtcccctcatagacttt
gacggcttgagcaggccaagcgtcggaacccgcgcaagactggaggagaccccggagcag
gcggcggagcggctggaacgcatgcgcggcgccgtcaggactctgctggaatgtgtcggt
gaggatccagatcggcagggcttgctggccacgcccgacaggtacgccaaggctctgctc
ttcctcaccaagggctaccaagagaacataaaagacattgtgaacaacgccatattccac
gaggggcacaacgagatggtcattgtcaaggacattgagattttcagcatgtgcgagcat
catctggtgccgttcaccggcaagatgcacataggttatattcctgccaactctgttatt
ggactttcaaagctgccccgcatcgcggagctcttcgcccgccgcctgcagattcaagag
cgtctgaccaaggaggtggcgaatgcaatctttgaggtgctcaagcctcagggtgttgca
gtggtgatggagtccagccatttgtgcatggtgacgcgcggtgtgcaaaagaccacggct
acaaccatcaccagctgcgtcctgggctgcttcgaaggccgggagaggactcgtaatgag
ttcctgagcctgattggtgtcaacaggcactga

DBGET integrated database retrieval system