KEGG   Magnaporthe oryzae: MGG_09565Help
Entry
MGG_09565         CDS       T01027                                 

Definition
CMGC/MAPK/ERK protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MGG_09565
Protein kinases [BR:mgr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MGG_09565
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGG_09565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 356 aa AA seqDB search
MSRANPPSNSSGSRKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDH
SMFCLRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQELMETDMHRVIRTQDL
SDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNS
GFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLIL
DVLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPKTSDLALDLLEKLLAFNPVKR
ITVEEALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDNLSKEQLKQFIYQEIMR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcgccaatccaccaagcaactcttcggggtctcgcaagatctcattcaacgta
agcgagcaatacgacatccaggatgtcgtgggcgagggcgcttatggagtcgtttgctct
gcgatccataagccttcgggccaaaaggttgccataaagaagatcaccccgttcgatcat
tctatgttctgcctacgaaccctccgcgagatgaagctgctccggtacttcaaccacgag
aacatcatttccatcctcgacatccagaagccccgaagctacgagaccttcaacgaggtg
tacctgatccaggagctcatggagactgacatgcaccgtgtcatccgcacccaagaccta
tccgacgatcactgccagtacttcatctaccagactctgcgtgctctcaaggcaatgcac
tcggcaaacgtgcttcaccgtgatctgaagccctcgaatctccttctcaacgccaactgt
gatttgaaggtttgcgattttggtctggctcgttctgccgcctcgcaagaggacaactcg
ggtttcatgacagaatacgtcgctacgcgttggtaccgtgctcccgagatcatgttgacc
tttaaggagtacaccaaggctattgacgtgtggtctgttggctgcattctggctgaaatg
ctcagcggaaagcctttgttccccggaaaggactaccaccaccagctcacgctgattctt
gacgttctcggcacacccaccatggaggactactatggtatcaagtcccgccgtgcaagg
gagtacattcgctcgctgccgttcaagaaaaaggttcctttcaggacactcttccccaag
acttcggatctcgccttggacctgttggagaagttgcttgcctttaaccccgtcaagcgc
atcaccgtcgaggaagctttgaagcacccttaccttgagccgtaccatgaccccgatgat
gaacccaccgcaccgccgattcccgaggagttctttgatttcgataagcacaaggataac
ctgagcaaagagcagctcaagcagttcatctaccaggaaattatgcggtaa

DBGET integrated database retrieval system