KEGG   Magnaporthe oryzae: MGG_09805Help
Entry
MGG_09805         CDS       T01027                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mgr  Magnaporthe oryzae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mgr00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mgr00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mgr00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:mgr00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 502 aa AA seqDB search
MFASAVRLLLAGLAASATAYITAGGEVVIPGASSYNGLNLVPQMGWNNWNAYHCDVSEEL
LLKTAEAMVTYGLRDLGYNYVVLDDCWSIGRNESGYLLHNPVKFPSGMKSIADKLHAMKF
KFGMYSSAGVFTCGRYPGSLGFEQKDADTFASWGVDYLKYDNCYNQGQSGTPQLSFNRYN
VMSKALNNTGRPMVYAMCNWGNDDPYDWAYTIANSYRMSGDIYDSFQRPDSRCPCTETPC
NWPGFHCSVMNILNKMAPITSRTQPGAFNDMDMLEVGNGGQSDSEYVLHFSMWAMMSSPL
LMGTNIPGLSPAHLSILSNPAVIALNQDVTGTSAVRKWREVITDDVDDDGQGEVALWTRV
MNNGDTVIALINAANSSRTMRATAKDIFLDQATAGTYLPAPELSTPYDVYDLWVNRMSDD
EAASVLAGNATSIGANSTSVTRYNATALGYAQGLSQDHPALFGKKVGRLAPGGVWEAQVD
RHSVGLFRLRNATQASRAKDEL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcttctgcggtccgtcttttgttggcaggcctagccgcctcggccacagcctac
atcacggccgggggagaagtggtgattcctggggcgagttcgtacaatggcctcaaccta
gtgccccagatgggctggaacaactggaacgcataccactgcgacgtttccgaggagctg
ctgctcaagacggccgaggcgatggtcacgtacggtctgcgtgacctgggttacaactac
gtcgtcctcgatgactgctggtccatcggccgcaacgagtcgggctacctgctgcacaac
cccgtcaagttcccaagtggcatgaagtcgatagccgacaagctgcacgccatgaagttc
aaattcggcatgtacagctccgccggcgtcttcacctgcggccgctacccgggcagcttg
ggtttcgagcaaaaggacgccgacacttttgcgagctggggggtcgactatctaaagtac
gacaactgctacaaccaaggccagtctggtacgccccagctcagcttcaaccggtacaac
gtcatgtccaaggctctcaacaacacgggccgccccatggtctacgccatgtgcaactgg
ggcaacgacgacccgtacgactgggcctacaccatcgcgaacagctatcgcatgagtgga
gacatttacgacagcttccagcggcccgactcgcgctgtccatgcacagagacgccgtgt
aactggcccggcttccactgctccgtcatgaatattctgaacaagatggcacccattacg
tcgcggacccagcccggggcttttaacgatatggacatgctggaggtgggcaacggcgga
caaagcgactcggaatacgtcctccacttctccatgtgggccatgatgtcctccccgttg
ctcatggggaccaacatccccggactgtcgcccgcacacctctcgatcctgtccaacccg
gccgtcatcgcgctgaaccaggacgtgactggcacctcggcggtgcgcaagtggcgagag
gtcattacagacgacgtcgacgacgacgggcaaggcgaggttgcactctggacgcgcgtg
atgaacaatggggacaccgtcatcgccctgatcaacgccgccaacagctcacgaaccatg
cgcgccacggccaaggacatctttctggatcaggcgacggccggcacctacctgcccgcc
ccggagctgtcgacgccctacgacgtctacgatttgtgggtcaatcgcatgagcgacgac
gaggccgcgtcggtcctcgccgggaacgccaccagcatcggcgccaacagcaccagcgtc
acccggtacaatgccacggcgttgggctacgctcaggggctgagccaggaccacccggcc
ttgtttgggaagaaggtcggccgcctcgcgccgggtggtgtttgggaagctcaggtcgac
aggcacagcgttggcctgtttaggctgcgtaatgcgacgcaagcgtcccgggcgaaggac
gagctgtaa

DBGET integrated database retrieval system