KEGG   Magnaporthe oryzae: MGG_09878Help
Entry
MGG_09878         CDS       T01027                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component-pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00010  Glycolysis / Gluconeogenesis
mgr00020  Citrate cycle (TCA cycle)
mgr00620  Pyruvate metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01200  Carbon metabolism
Module
mgr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_09878
   00020 Citrate cycle (TCA cycle)
    MGG_09878
   00620 Pyruvate metabolism
    MGG_09878
Enzymes [BR:mgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MGG_09878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF3614 Cuticle_1
Motif
Other DBs
NCBI-GeneID: 2680788
NCBI-ProteinID: XP_003720354
UniProt: G4NIC7
Position
6
AA seq 464 aa AA seqDB search
MFAPILRRRALQKTSSLRYVTPALTRWYASYPPHTVVKMPALSPTMTAGNIGAWHKKPGD
GIAPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETGEKDIAVGNPIAVLVEEGTDVKAFE
NFTLADAGGEAPASSPPKEEKNVEESSKAASTPTPTPAPEPENTKSAGRLQNALDREPNA
EPAAKRLANEKGIKLDGVKGSGKNGKITAEDVKKLGSSGPAAAAAAGPAGALYEDIPISN
MRKTIANRLKESVSENPHYFVSSSLSVSKLLKLRQALNSSSEGKYKLSVNDFLIKAIAVA
SKKVPQVNSSWRDGVIRQFNTVDVSVAVSTPSGLITPIVKAVETKGLESISASVKELAKR
ARDNKLKSDEYQGGTISISNMGMNTAVERFTAVINPPQAAIVAIGTTKKVAVPVENEDGT
TGVEWDDQIVITGSFDHKVVDGAVGAEWMKELKTVVENPLQLLL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccccgatcctcaggaggcgtgccctccagaagaccagcagcttgcgatatgtc
accccggcgctgacaagatggtacgcgtcgtacccgccacacaccgtcgtgaagatgccg
gcactatcgcctacaatgacggccggtaacattggggcctggcacaagaagcccggtgac
ggcatcgctccgggcgacgtccttgttgagattgagaccgataaggcccagatggacttt
gagtttcaagaggagggtgttcttgccaaggtcctgaaggagacaggcgagaaggacatt
gcagtcggaaacccgatcgccgttcttgtcgaggagggcactgacgtcaaggccttcgag
aacttcactctcgcggatgctggtggagaggctccagcctcatccccgccgaaggaggag
aagaacgtcgaggagtcctcgaaagccgcctctaccccgacaccaaccccggcccccgaa
cctgagaacaccaagtcggccggcaggctgcagaatgctctcgaccgcgagcccaatgca
gagccagcggcgaagcgtctcgccaacgaaaagggaatcaagctcgatggcgtgaagggt
tctggcaagaatggcaagatcacggccgaggatgttaagaagctgggctcgagtggccct
gccgcggctgccgctgcaggacccgccggtgcgctctatgaggacatccccatcagcaac
atgcgcaagaccattgccaaccgtctcaaggagtccgtttccgagaaccctcactacttc
gtttcctcgtctctctccgtctccaagctcctcaagctgcgtcaggccctgaacagctcg
tccgagggcaagtacaagctcagtgtcaacgacttcctgatcaaggccatcgctgttgca
tccaagaaggtgccgcaggtcaactcttcgtggcgcgacggtgtgattcgccagttcaac
actgttgatgtctccgttgctgtttccaccccatccggcctgatcactcccattgtcaag
gctgttgagaccaagggtctggagagcatttccgcttcggtcaaagagctggccaagcgg
gcccgtgacaacaagctcaagtctgatgagtaccagggcggcaccatttccatctccaac
atgggcatgaacacggccgtcgagcgcttcaccgcagtcatcaacccaccgcaggctgcc
attgtcgccattggcaccaccaagaaggttgccgtgccagtcgagaatgaggatggtacc
actggtgttgagtgggatgaccagatcgtcatcactggtagcttcgaccacaaggttgtc
gatggtgctgtgggtgccgagtggatgaaggagctcaagacggttgttgagaaccctctg
cagctccttctgtag

DBGET integrated database retrieval system