KEGG   Magnaporthe oryzae: MGG_09878Help
Entry
MGG_09878         CDS       T01027                                 

Definition
dihydrolipoyllysine-residue acetyltransferase component-pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_09878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_09878
   00020 Citrate cycle (TCA cycle)
    MGG_09878
   00620 Pyruvate metabolism
    MGG_09878
Enzymes [BR:mgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MGG_09878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 464 aa AA seqDB search
MFAPILRRRALQKTSSLRYVTPALTRWYASYPPHTVVKMPALSPTMTAGNIGAWHKKPGD
GIAPGDVLVEIETDKAQMDFEFQEEGVLAKVLKETGEKDIAVGNPIAVLVEEGTDVKAFE
NFTLADAGGEAPASSPPKEEKNVEESSKAASTPTPTPAPEPENTKSAGRLQNALDREPNA
EPAAKRLANEKGIKLDGVKGSGKNGKITAEDVKKLGSSGPAAAAAAGPAGALYEDIPISN
MRKTIANRLKESVSENPHYFVSSSLSVSKLLKLRQALNSSSEGKYKLSVNDFLIKAIAVA
SKKVPQVNSSWRDGVIRQFNTVDVSVAVSTPSGLITPIVKAVETKGLESISASVKELAKR
ARDNKLKSDEYQGGTISISNMGMNTAVERFTAVINPPQAAIVAIGTTKKVAVPVENEDGT
TGVEWDDQIVITGSFDHKVVDGAVGAEWMKELKTVVENPLQLLL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccccgatcctcaggaggcgtgccctccagaagaccagcagcttgcgatatgtc
accccggcgctgacaagatggtacgcgtcgtacccgccacacaccgtcgtgaagatgccg
gcactatcgcctacaatgacggccggtaacattggggcctggcacaagaagcccggtgac
ggcatcgctccgggcgacgtccttgttgagattgagaccgataaggcccagatggacttt
gagtttcaagaggagggtgttcttgccaaggtcctgaaggagacaggcgagaaggacatt
gcagtcggaaacccgatcgccgttcttgtcgaggagggcactgacgtcaaggccttcgag
aacttcactctcgcggatgctggtggagaggctccagcctcatccccgccgaaggaggag
aagaacgtcgaggagtcctcgaaagccgcctctaccccgacaccaaccccggcccccgaa
cctgagaacaccaagtcggccggcaggctgcagaatgctctcgaccgcgagcccaatgca
gagccagcggcgaagcgtctcgccaacgaaaagggaatcaagctcgatggcgtgaagggt
tctggcaagaatggcaagatcacggccgaggatgttaagaagctgggctcgagtggccct
gccgcggctgccgctgcaggacccgccggtgcgctctatgaggacatccccatcagcaac
atgcgcaagaccattgccaaccgtctcaaggagtccgtttccgagaaccctcactacttc
gtttcctcgtctctctccgtctccaagctcctcaagctgcgtcaggccctgaacagctcg
tccgagggcaagtacaagctcagtgtcaacgacttcctgatcaaggccatcgctgttgca
tccaagaaggtgccgcaggtcaactcttcgtggcgcgacggtgtgattcgccagttcaac
actgttgatgtctccgttgctgtttccaccccatccggcctgatcactcccattgtcaag
gctgttgagaccaagggtctggagagcatttccgcttcggtcaaagagctggccaagcgg
gcccgtgacaacaagctcaagtctgatgagtaccagggcggcaccatttccatctccaac
atgggcatgaacacggccgtcgagcgcttcaccgcagtcatcaacccaccgcaggctgcc
attgtcgccattggcaccaccaagaaggttgccgtgccagtcgagaatgaggatggtacc
actggtgttgagtgggatgaccagatcgtcatcactggtagcttcgaccacaaggttgtc
gatggtgctgtgggtgccgagtggatgaaggagctcaagacggttgttgagaaccctctg
cagctccttctgtag

DBGET integrated database retrieval system