KEGG   Magnaporthe oryzae: MGG_09907Help
Entry
MGG_09907         CDS       T01027                                 

Definition
ubiquitin carboxyl-terminal hydrolase 13
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
mgr  Magnaporthe oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 766 aa AA seqDB search
MGWKDKIFRGTGAGTSGSSGNASASKKKEKEEPPPELTPLEKLLQNAGAVREDGSDKFFG
LENFGNTCYCNSIVQALYYSEIFRESVVNYPPFSPSDTPNGKRAKISVQIRPPPKKEAED
EPQGKKKTSTKDVLKQRQMINSGQGGPGLQPTRPEDKPDSPEYKKKQAMLKGPVLELAQE
NSASYGMDESTFTGLKDLFLALIESQSRTGVLSPQRFLEIFKRDNEMFRNSMHQDAHEFY
GLVLNDVISTVEANAKRLQEQEQAAAKDGLAKSVEDALSPTNALVKAPAGYRSPGTGWVH
DIFEGLLTSETRCLTCETASQRDETFLDLSIDLDEHSSVTSCLRKFSAEEMLCERNKFHC
DHCGGLQEAEKRMKIKRLPKVLALHLKRFKYTEDYSRLQKLFHRVVYPYHLRMFNTTPDA
EDPDRVYELYAVVVHIGGNAYHGHYVSVIKTADRGWLLFDDEMVEPVDKHFVRNFFGDRP
GMACAYVLFYQETTLEKAMEEEDYEGIEEIRLATQTADLASDKPSGAESLPPLEKPLTTP
IPPVADHDAMAALDHALTAPNGTTPAVPQTPANPSVPAVPAEAPFSHPLVAAPPKPAAEI
KPSSKEDKAREKQLQKEKKAAEKEQVKREEKERKERESRQREARKSEQEDLRRAMEASKQ
TAAEEEQKQKADNALSSKEAPTSPALGGGIGNLMKRGSLSRASLGFLNREKEKEKDKSSG
NGVANGSSSDHAANGSAASPHPESPASLKKKFSFALGRKKSTHVLS
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgggttggaaagataaaatattcagaggcaccggtgctggtacatcgggctcttcggga
aatgcctccgcaagcaagaagaaagagaaggaggaaccgccacccgaattgacgcctctg
gagaagctgctacagaacgccggggcggtccgagaagacggcagcgacaaattctttgga
cttgaaaactttggcaatacatgctattgcaactcgatcgtccaagccctctactactcc
gaaatattcagagagagtgtcgtcaactaccctccgttctcaccttcggacactccaaat
ggcaagcgcgcgaagatcagtgtgcaaataaggccaccgccgaaaaaggaagccgaggat
gaaccacagggaaagaaaaagacatcaacaaaagatgtcttgaaacagaggcaaatgatc
aattcgggccaagggggtcctgggctgcaaccaacgcggcctgaagataagcccgactca
cccgagtacaagaagaagcaggccatgctcaaaggccctgtacttgagttggcgcaggag
aattcggcctcgtacggaatggacgagagcacattcacggggctgaaggacttgttcttg
gccttgatcgaaagtcagtcaagaaccggtgtactaagtccacaacgctttcttgagatc
ttcaaacgcgacaatgagatgttcaggaattcgatgcatcaagatgcacatgagttctat
ggcttggttcttaacgatgtcatatctaccgttgaggccaacgcgaaacggctgcaagag
caagagcaagcggccgccaaggatggccttgcgaaatccgtcgaagacgcgctgagtcca
acgaatgcgctcgtcaaagctccagcaggctacaggtcaccagggactggctgggtgcac
gatatatttgagggtcttttgacgtcagagaccaggtgccttacgtgtgagacggcatcg
cagagagacgaaacattccttgatctatctatagacttggacgaacattcgtcagtaacg
tcatgtcttcggaagttctcggcagaggaaatgctatgcgagaggaacaagtttcattgc
gaccattgtggtggtttgcaagaagcagagaagcgcatgaagattaagagacttcccaag
gtcctcgctctgcacctaaagcgcttcaagtacacggaagactacagtcggttgcagaag
ctgttccacagggtcgtgtatccctaccatctgaggatgtttaacacgacgcctgacgcg
gaggatcctgatcgggtatacgagctttacgcggtcgtggtgcacataggcggaaacgcc
taccatgggcattacgtatcggtcatcaaaacagcagacagaggatggctactgttcgac
gacgagatggtggagcctgtggacaagcactttgtgcgcaacttcttcggtgatcgaccg
ggaatggcatgcgcatatgtgcttttctaccaggagacaacattggagaaggctatggag
gaggaggactatgaaggcatcgaggaaataagattggcgacgcagacagcagatcttgct
tctgacaaacccagcggcgctgagagcctgcctccactggagaagccccttaccacgccg
ataccaccggttgcagaccacgatgccatggcagcgctcgatcatgcattgacggcacca
aacggcacgactccggcggtaccacaaacgcccgccaatccgtccgttccagctgtgccc
gcagaggcacccttcagccacccactagtggccgctccacctaaacccgcagccgaaatt
aagccttcttcaaaagaggacaaggctcgggagaagcagctacagaaggagaaaaaggcg
gcagagaaggaacaggtcaagcgtgaggaaaaggagcgcaaagaaagagagtcaaggcaa
cgagaagcccgcaagtctgagcaggaagatttgcgtagagccatggaagcaagcaaacag
acggctgcagaagaggaacaaaaacaaaaggcagacaacgcgctgtcatccaaggaagcg
cctacctcgcctgcattgggaggaggtattggcaacttgatgaagagaggcagtttatca
cgcgccagtttgggcttcctcaacagggaaaaggaaaaggagaaggataagtcatctggc
aacggcgtggcaaatgggtcatcgtcggaccacgcagcaaacggctcggcggcgtcaccg
catcctgagagcccagcgtcgctgaagaagaagttcagttttgcgctgggcagaaagaaa
agcacgcatgtcctgtcttag

DBGET integrated database retrieval system