KEGG   Magnaporthe oryzae: MGG_10083Help
Entry
MGG_10083         CDS       T01027                                 

Definition
endoglucanase 3
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mgr  Magnaporthe oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 376 aa AA seqDB search
MKSIFALGALISAAAAQAPAWAQCGGNGHTGPTTCVSGHSCVVVNEWYHQCQPGASNPPG
NGGGSPGGGGGNGKFIFFGTNEAGAEFGQDTLPGVWGKEYTFPEPSTIDTLMSQGYNTFR
VCMAMERLADKGLTGAFNQAYLRNLTTVVNHITNKGGWAVIDPHNYGRYNKAIITDTSAF
RTFFVNLGTAFKSNSKVVFDTNNEYNTMDQNLVLRLNQASIDGIRAAGATSQYIFVEGNA
WSGAWSWNTTNDNMKALTDPQNKLVYEMHQYLDSDSSGTSPDCVSANIGVQRIVGATEWL
RANKKVGMIGEFAGGPNEQCKAAVKGMLDHMKQNSDVWLGALWWAAGPWWGDYMYGFEPP
SSTAYVYYNSLLKTYL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctatttttgccctcggcgccctcatcagcgccgccgccgcgcaggctcccgcg
tgggcgcagtgcggtggaaacggccacaccggtccgaccacttgcgtctcggggcactcg
tgcgtcgtggtgaatgagtggtaccaccagtgtcaacccggcgcgtcaaaccctccgggc
aatggcggcggcagtcctggtggtggcggcggcaacggcaagttcatcttttttggcacc
aacgaggccggtgccgagtttggccaggacactctccctggcgtatggggcaaggagtac
acgttcccggagccttctaccattgatactctgatgagccaaggctacaacacgttccgc
gtctgcatggcaatggagcgactggcagacaaggggctgacgggcgccttcaaccaagcg
tacctccgcaacctgacgacggtggtcaaccacatcaccaacaagggcggctgggcggtg
atcgacccgcacaactacgggcggtacaacaaggccatcatcaccgacacgtcggccttt
cggacgtttttcgtcaacctgggcacggccttcaagagcaacagcaaggtggtgtttgac
accaacaacgagtacaacaccatggaccagaacctggtgctccggctcaaccaggccagc
atcgacggcatccgggcggcgggcgcgacgtcgcagtacatcttcgtcgagggcaacgcg
tggtcgggggcgtggtcgtggaacacgaccaacgacaacatgaaggcgctcacggacccg
cagaacaagctcgtgtacgagatgcaccagtacctcgactcggactcgtcgggcacgtcg
cccgactgcgtgagcgcaaacattggcgtgcagcgcatcgtgggcgccaccgagtggctc
agggccaacaagaaggtcggcatgattggcgagttcgccggcgggcccaacgagcagtgc
aaggccgccgtcaagggcatgctggaccacatgaagcagaacagcgacgtctggctgggt
gccctgtggtgggctgccgggccctggtggggcgactacatgtacggctttgagccgccc
agctccacggcctacgtctactacaacagtctgttgaagacgtacctgtga

DBGET integrated database retrieval system