KEGG   Magnaporthe oryzae: MGG_10195Help
Entry
MGG_10195         CDS       T01027                                 

Definition
serine/threonine-protein phosphatase PP1
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mgr  Magnaporthe oryzae
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    MGG_10195
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    MGG_10195
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     MGG_10195
Protein phosphatases and associated proteins [BR:mgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     MGG_10195
Transcription machinery [BR:mgr03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     MGG_10195
Spliceosome [BR:mgr03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    MGG_10195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 309 aa AA seqDB search
MADQHDVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKFGRGR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcggatcaacacgacgtcgacctcgactcgattatcgaccgtctgctcgaggtccga
ggcagccgcccgggaaagcaagtccagcttctcgaagctgagattagatacctgtgcacc
aaggcccgggagatttttatctcacagcctatcctgcttgaactcgaagctcctatcaag
atttgcggcgatatacacgggcagtactatgacttgctgagactttttgagtacggcggt
ttccccccggaagccaactacctgttcctcggtgactacgttgatcgtggcaagcagtcc
ctggagactatttgccttttgctcgcgtacaagatcaagtacccggaaaacttcttcatc
ctgcgcggcaaccacgagtgtgcctcaatcaatcgtatctacggcttttacgatgagtgc
aagcgtcggtataacatcaagttatggaagacattcaccgactgcttcaactgcctcccg
atcgctgccatcattgacgagaagatcttcaccatgcatggcggcttgagtccggacttg
aactccatggagcagattcgccgtgttatgcgcccgacggacatccccgactgcggcctg
ctatgtgacctactttggtccgatcctgacaaggacattactggctggagcgagaatgac
cgtggtgtttcgttcacctttggtcccgacgttgtttcgcgattcctgcagaaacacgac
atggacttgatctgccgtgcccaccaagtcgtcgaggacggatacgagtttttctcgaaa
cgacaactggtaactctgttcagcgcacccaactactgtggcgagttcgacaacgcgggt
gccatgatgtccgtggacgagagtttgctgtgctcattccagattcttaagccagctgag
aagaaacaaaagttcggacgcggtcgctag

DBGET integrated database retrieval system