KEGG   Magnaporthe oryzae: MGG_10585Help
Entry
MGG_10585         CDS       T01027                                 

Definition
monooxygenase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGG_10585
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MGG_10585
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     MGG_10585
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 335 aa AA seqDB search
MLAINLILSALLPTVAIAAPTTTNTTAACTNPQKRVEFRKLTATDRQQYVDAIFCMSKKP
SELGRSLTTSRLADFTYVHALLNNDIHFVAQFLPWHRWFLHLYEQDLRKCGYEGPLAYWD
WTLDHADIPNASIWDPVSGIGGNGVAPPGVSRRQDEMADFGVDRTQPIYYFCVGDGPFKD
LEVEYKSANYVPHCLTRNFNNGNFYPGDMNGWAVAPDTIANIMAKPGYDDFRQWLEGQPH
GAIHSAIGGDMGPSSSPNDPVFFLHHAQVDRLWLQWQQQSPAKAADYGGRRTRDLPEGHQ
TSALTDIMEMVGLGNNLEVADVMSVQSELLCYEYV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccataaatctcatcctctccgcgctcttgcccacagtcgcaatcgccgcaccg
acaaccaccaacacaacagcagcatgcacaaacccccagaagcgcgtcgagttccgcaag
ctcaccgcgaccgacaggcagcagtacgtcgacgccatcttctgcatgtccaagaagccc
tctgagctcgggaggagcctgaccacgtcccgcctggccgacttcacctacgttcacgcc
ttgctcaacaacgatatccactttgtggcccagttcctgccctggcacaggtggttcctg
cacctatacgagcaggacctgcgcaagtgcggctacgagggccccctggcctactgggac
tggacgctcgaccacgcggacatacccaacgccagcatctgggatcccgtgtctggcatc
ggcggcaacggcgtggccccgccgggcgtgagccggcgccaggacgagatggccgacttt
ggcgtcgaccgtacccagcccatctactacttttgcgtgggggacgggccgttcaaggac
ctcgaggtggagtacaagagcgccaactacgtgccgcactgcctgacccgcaacttcaac
aatggcaacttttaccccggcgacatgaacgggtgggccgtcgcgccggacaccatcgcc
aacatcatggccaagcccggctacgacgacttccgccagtggctcgagggccagccgcac
ggcgccatccacagcgccatcggcggcgacatgggcccgtccagctcgcccaacgacccc
gtcttcttcctgcaccacgcccaggtcgaccgcctgtggctgcagtggcagcagcagagc
cccgccaaggctgccgactatggtggcaggaggacccgcgacctgccagagggccaccag
acgtcggcgctgaccgacatcatggagatggttggtttgggcaacaaccttgaggtggcg
gatgtcatgagcgtgcagagcgaactgctgtgctacgaatatgtctaa

DBGET integrated database retrieval system