KEGG   Magnaporthe oryzae: MGG_10826Help
Entry
MGG_10826         CDS       T01027                                 

Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:mgr04111]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 905 aa AA seqDB search
MSIVSPTPMGGSQFTTLGRRTSTRQALRRPPSRQQLSHRPTSDSNPIGSSRATDSNLQGG
AQKYVNDNDSSDEEIPVPMKLSALTKALLDDGGPSAAAANAAQPAAIPTRNMSYLDRGLE
HKDSEREVSTLRESRRNVRAGSAQLTSSPNRGVEPSSAPRKRVVRLSSTNVSVNTTPGGS
SLQSKVRRSSTHKRAPSKDRTDERNKVSGPEPVVSQDSTAAADSVAGINTPVSGARRVRI
VSNSSATRGRTHGSTLRSSSSAGTSRLPSSAAHSDHEQPEEPRTEHRTRTSLNNSSGANT
ARKPDDAAPQSLMRMKRIGQLPGSFLSGPARRGRRRQSDEEENAPADEQYPDQYMHGLRE
HEPESIARHQPGSGAGSSFRLSSYRDQAAASGSPVSIKDPARAALRNKTSPGSSAKTDAE
TNKENVPPEEAHEPAPVFQPVLPSALDQENAVSAAVARSKEVISMHEKLASRDPAPLPQV
QAPVIPKQRAPSPDRKVLSHMSRNTPLRPAPPPPPKMSVLDAVTSTAGAATTAQAIKKQR
VLLKVNGRAYNRLDCIGRGGSAKVYRVTAENGKMFALKRVSLENADTTAVKGFLGEIELL
RRLSGVDRVIQMYDSELNQEKKLLSVLMEMGELDLGDLLKSRHSQEDYKLDTVFVRFIWK
EMLECLQSVHACDIVHSDLKPANFVMVKGRLKLIDFGIAGAIQTDETVNVHRENQIGTPN
YMSPESLMDSAHYSATAANNGRPDRSLNRTRVMKLGKPSDVWSLGCILYQLVYGTPPFGH
IPNQLARCQAIIAWDHKISFPEKGAGGVFVPPSLVRTMKRCLIRDQQYRPTCEELLTETD
PFLYPQEVDMDRVLPMTEELLARVIHSVVNRCRDRMPTDGELMTAWPNAYWASVKKSVGS
KEARS
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgtatcaccaacgcctatgggcggaagccagttcacgacattgggcaggcgg
acgtcgacgaggcaggctttgaggcgcccgccatcgcgacagcaactatcccatcggcca
acgtccgactcgaatccgattggcagttctcgagctacagacagcaacctccagggtggc
gcacaaaaatacgtcaacgacaacgacagctccgacgaagagattcccgtgcctatgaag
ctcagcgctctcaccaaagcactccttgacgatggcggtccctctgctgctgctgccaat
gcggcccaaccagcagcgattcctacgcgcaacatgagctatctcgatcggggtttggag
cataaggactcagagagggaggtcagcaccttgcgtgaaagtcgtcgcaatgtgcgggct
ggcagcgcgcagctcacctcgtcaccaaaccgcggtgttgagcccagctctgctccaagg
aagagggttgtccgtctaagctccaccaacgtaagcgtcaacaccactcctggtgggtct
agccttcaaagcaaggttcggaggtcatccactcataaaagagcgccgagcaaggacaga
acggatgagagaaacaaggtatcgggccccgagccggtcgtcagtcaggactctactgca
gccgccgactctgttgctggtataaatacccctgtttccggcgccaggagagtgcgcatt
gtttctaactcctcggccactcgaggtaggacgcatgggtctactctcaggtcgtccagc
tcggccggcacatctcggcttcccagctccgctgcgcacagtgaccatgagcaaccagaa
gagccgaggacggagcacaggacaaggacatcactgaacaacagcagcggcgccaacacc
gcaaggaaacctgacgatgccgctcctcagagcttgatgcgcatgaagcgaatcggccag
cttcctgggagctttcttagtggtcccgcccgccgaggtaggagacggcagagcgatgag
gaggaaaacgcaccagcagatgaacaatatccggatcaatatatgcatggactgcgggaa
catgaacctgaaagcattgcgaggcatcagcctggatcaggtgccggctcctcatttcgc
ctgtccagctatagagaccaagctgccgcatccggaagcccagtcagcatcaaggatccg
gcacgagctgcgctccgtaacaaaacatcaccgggttcctctgcaaagacagacgccgag
actaataaggagaacgttccgcctgaagaagcacatgaacccgcacccgtctttcagccg
gtgcttccgtccgcacttgaccaggagaacgccgtctcagccgctgttgctaggtcaaaa
gaagtcatttccatgcatgagaagttggccagcagagatcctgcgccactccctcaagta
caagcacctgtgataccaaagcaaagggcgccatcaccagaccgcaaagttctctctcac
atgagcagaaataccccattgaggccagccccccctcctccgcccaaaatgagcgtattg
gatgctgttacttccaccgccggggccgctaccaccgcccaagccatcaagaagcagcga
gtgcttctcaaggtcaacgggcgggcatataataggctggactgcattggtcgaggcggc
agtgcaaaggtctatagggtaacagctgagaacggcaagatgtttgctctcaaacgagtg
tcccttgagaatgccgacaccacggcggtcaagggatttttgggcgagattgaactgctc
agacgcctttccggggttgaccgcgtcatccaaatgtacgactctgaactcaaccaggag
aagaagttgctcagtgtgcttatggagatgggtgagcttgacctaggcgatctgctcaaa
tcaaggcatagccaagaggactataaactcgacactgtctttgttcgcttcatatggaag
gagatgctggagtgtttgcagtccgtacatgcctgtgacatcgttcattccgatctcaag
ccagcaaattttgtcatggttaaagggcgactgaagctcatagattttggcattgctggc
gccatccagacggacgagacggtcaacgtccaccgtgaaaatcaaatagggacgccaaac
tatatgtcccccgaatcgctcatggactctgctcactattcagccacagcggccaataac
ggacgtcctgaccgatcactcaaccggacgagggtgatgaagctgggcaagcccagcgac
gtctggagcttgggatgcattctatatcaactagtatacggaacgccgcccttcgggcat
atcccaaaccagctggctcgctgtcaggccatcattgcgtgggatcacaagatcagcttc
cccgagaagggcgccggcggcgtcttcgtcccaccttcgctcgtccgaacgatgaagagg
tgtctgattcgcgaccaacaataccggccgacctgcgaggagctcctcacagagactgac
cctttcctctatccgcaagaggtcgacatggaccgcgtcctgcccatgacggaggagctt
ctggcaagggtcatccacagcgttgtcaaccgctgtcgcgaccgcatgccgaccgatggc
gagctcatgacggcgtggccaaacgcatactgggcttcggtgaagaagagtgtggggagc
aaggaagcgagatcgtga

DBGET integrated database retrieval system