KEGG   Magnaporthe oryzae: MGG_10854Help
Entry
MGG_10854         CDS       T01027                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00220  Arginine biosynthesis
mgr00330  Arginine and proline metabolism
mgr01100  Metabolic pathways
mgr01110  Biosynthesis of secondary metabolites
mgr01130  Biosynthesis of antibiotics
mgr01230  Biosynthesis of amino acids
Module
mgr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MGG_10854
   00330 Arginine and proline metabolism
    MGG_10854
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MGG_10854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 2676370
NCBI-ProteinID: XP_003713240
UniProt: G4N388
Position
3
AA seq 357 aa AA seqDB search
MSSTHATQNGSNSQTDASTPDYTKTPPVMLTTMVESKFLSSPEDLGVVAVGFSGGQCKPG
VDAAPSALIDSGLLTQLHSELGYRLHGHTQVHLYGDLEPANDPPYRNMKKPLAVSAVTRR
IAEQTYEQAKEGRMVLTLGGDHSIAIGTIGGVAKAIKERFQGRREVAVIWVDAHADINTP
ETSDSGNIHGMPVSFLTGLATEDKDEYFGWLKDDNRISVNKLVYIGLRDVDPGEKKILRE
NKIKAFSMFDIDRHGIGRVMEMALAHIGTDTPIHLSFDVDALDPMWAPSTGTPVRGGLTL
REGDYICECVHETGQLVAMDLVEVNPSLSPSDGDPGAHETVRAGCSLVRCALGESLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaacacatgctacccagaacgggtcgaattcccagaccgacgcttctacgcca
gactacaccaaaacccctcccgtcatgttgaccacaatggtggagagcaagttcctctcg
agcccagaggacctgggagtcgtggccgttggattctctggaggccagtgcaaacctggt
gttgacgccgccccctcggctctcatcgactccggcctcctcacgcagctccactcggaa
ctcggttaccgcctgcatggccacacccaggttcatctgtacggagacctcgagccggca
aacgaccccccgtatcgaaacatgaagaagccgctcgccgtgtcagctgtgacgcgccgg
atcgcagagcagacgtacgagcaggcgaaagaaggccgcatggtgctcaccctgggtggc
gaccatagcatcgccatcggaacaatcggcggggtcgccaaggccatcaaggagcggttc
cagggccggcgcgaggtggccgtcatttgggtggatgcgcacgcggatatcaatacgccg
gaaacttcggacagcggaaacatccacggcatgcctgtgtctttcctaacgggattggca
acggaggacaaggacgagtactttggctggctgaaggatgacaaccgcatcagcgtcaac
aagcttgtttacattggtctgcgggacgtggacccgggcgaaaagaagatactgcgcgag
aacaagatcaaggcatttagcatgtttgatattgacaggcacggaatcggtcgcgtcatg
gagatggcactggcgcatatcggcaccgatacacccatccacctctctttcgacgtggat
gcgctcgaccccatgtgggctcccagcacggggacgccggtccgtggtggcttgacgctg
cgcgagggagactacatttgcgaatgcgtacacgagacgggacaactggttgctatggac
ttggtcgaggtgaaccctagcctgtcgccgagcgatggagaccccggggcgcacgagaca
gtcagggctggatgcagcttggtgagatgcgcattgggagagagtttgctgtaa

DBGET integrated database retrieval system