KEGG   Magnaporthe oryzae: MGG_11289Help
Entry
MGG_11289         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
mgr  Magnaporthe oryzae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MGG_11289
  Lipid metabolism
   00600 Sphingolipid metabolism
    MGG_11289
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MGG_11289
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MGG_11289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1047 aa AA seqDB search
MAFPVALPDWSNLAVLHTNALPARAHFYSYASETAALTHDRHQSEYHSLNGTWKFHYAAS
PFEAPPFEPENTASWADIEVPGMWQLQGYGHPHYTNIKFPFPVTPPNVSYINPTGSYFRE
FEVPDGWDGQQIRLRFEGVDSAFHVQVNGRPVGYSSLGSRNPSEFDITPYLGGGKTNNVS
ARVYQWSHGTYIEDQDQWWLSGIFRDVYLMPFAKSSIVDFQVHPELDAALTTGTLRTAVE
IQGDEGLLNIKLLGPGGNNTIGEWDGPSSQISDAIFTVTGDDLHIWSAETPSLYTALMTF
NGRTISQRLGFRRMERSADGSTFLVNGKAIKIYGVNRHEHHHLSGRTVPYAALRHDLLAM
KRHNINAIRTSHQPPHPDFFDLADELGFYVIAEADLECHGFGDKGSSVPPESYTTDNPEW
RDAYVNRAEQLVRRVRNHVSVIFWSLGNECFMGQNMFAMAEWIRAADPTRLIHYEQDYGG
VLADVHSRMYSSPQWIREWVVNKTDKPLILCEYAHAMGNGPGSLVDYIAAFRSNVRAQGG
LIWEWSNHGLLKKEGDLEYYAYGGDFGDFPNDADFIMDGLMLSDHSPMPSIFEYKKVIQP
IVAAWAGEGSASGQVVITNHYGFVDSSHLEASWHVVQDGKKTEPAVLDVPAVAAGDSVTV
ATPLDDSQLEAGEAFLVLEFRLANATNWADQGHLVAWDQLHIPARAAAAHKTRGSSYNHS
AYRPRAQDIMNLGQTDPTSNGTHLQVTAGTSTFGFDLLRGNVTWTVDGGPSILQRGPELS
FMRASTQNDEAGGGDARQSWDPARVHELHPQVRDVRWRQGDDGVTTVHYRIRVAPKVFVW
GVDADVVYTVDPQPDSGVPALTVRAAGSFHNDTAVELQTLPRIGLLAWLPAALDEVAWFG
RGPHETYRDSKQAGRFGNWNATVDELRTTYDYPQENGNREDARWVSVRSREGRAALRASM
VDSDGGGNSHNDAHGETFAFAAARYMPEDLNRAKHPHELRKLDVTVLNLDYRGNGLGSAT
VGPRPLEQYRCKPEPFDFTFRLEVLKG
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccccgtagccctgcccgactggagcaacctggcagtgctgcataccaatgcc
ctgccagctcgagctcacttttactcgtacgcatccgagactgcagccctcacccacgat
cggcaccagtccgagtatcacagcctgaatggcacgtggaaattccactacgccgcaagc
ccatttgaggcaccaccctttgagccggaaaacacggcatcgtgggccgacatcgaggtg
ccgggcatgtggcagctccaggggtacgggcatccgcactacaccaacatcaaattcccg
ttccccgtcacgcctcccaacgtctcgtacatcaacccgaccgggtcctactttcgcgag
tttgaggtgccggacgggtgggacggccagcagatccgcctgcgcttcgagggcgtcgac
agcgcgttccacgtgcaggtgaatggccgaccggtcgggtacagcagcctgggcagccgc
aacccgagcgagttcgacatcacgccctacctcggcggcggcaagacgaacaacgtgtct
gccagggtttatcagtggtcgcacggcacgtatatcgaggaccaggaccagtggtggctg
tcgggcatcttccgggacgtgtacctgatgccgtttgcaaagtcgtcgattgtggatttt
caggtgcatccagagctcgacgcagccctcacgaccggcactctccgcaccgcggtcgag
atacagggcgacgaaggacttctaaacatcaagcttctgggtccgggcggcaacaataca
atcggcgaatgggacggcccctcgtcgcaaatcagcgacgccatcttcaccgtaaccggc
gacgacctgcacatctggtccgccgagacgccgagcctctacacggccctgatgaccttc
aacgggcgcaccataagccagcgcctcggcttccggcgcatggagcgcagcgccgacggc
tcgacctttctggtgaacggcaaggcgatcaagatttacggcgtgaaccggcacgaacac
caccacctgtcgggccggacggtgccgtacgcggcgctccgccacgacctgctcgccatg
aagcggcacaacatcaacgcgatccggacgtcgcaccagcccccgcacccagactttttc
gacctggccgacgagctggggttttatgtcattgccgaggcggacctcgagtgccacggc
tttggcgacaagggcagcagcgtgccgcccgagtcgtacaccaccgacaaccccgagtgg
cgagatgcctacgtgaaccgggccgagcagctggtgcgccgcgtgaggaaccacgtgtcg
gttattttttggagcctggggaacgagtgcttcatgggtcaaaacatgttcgccatggcc
gagtggatcagggccgcggacccgacgaggctcattcactacgagcaggactatgggggt
gtgctggctgacgtccacagcaggatgtactcgagtccgcagtggattcgcgagtgggtg
gtcaacaagacggacaagccactgattttgtgcgagtacgcgcacgcaatgggcaacggc
cccggctctctggtcgactacattgccgccttccgatccaacgtccgcgcccaaggcggt
ctgatctgggagtggtccaaccacggactgctcaagaaggagggcgacctcgagtactat
gcctacggcggagactttggcgactttcccaacgacgcagactttatcatggacggcctg
atgctgtcggaccactcccccatgccgtctatcttcgagtacaagaaggtgatccaaccg
atcgttgcagcttgggccggcgagggctccgcctcgggccaggtcgtcataaccaaccac
tatgggttcgttgactccagccatcttgaggcgagctggcatgttgttcaagacggaaaa
aagacggagcctgcggtacttgatgtgcccgccgtggcagctggggatagcgtgacagtt
gccacgccgcttgatgacagccagctcgaagccggcgaagccttcctcgtcctcgagttc
cgcttagccaatgccacgaactgggcagaccagggccacctagtcgcctgggatcaacta
catatccccgcccgggcagcggcagcccacaagacccgaggcagcagctacaaccacagc
gcctacagacccagagcgcaggacattatgaacctgggccagaccgacccgacctccaac
ggcacccacctccaagtgacggctggaacatcgacctttggtttcgaccttttacgcggc
aacgtgacatggaccgtcgacggcggtccgtcgatcctgcagcgcgggccggagctcagc
ttcatgcgcgcgtcgacgcaaaacgacgaggccggcgggggcgacgcccgccagtcctgg
gacccggcgcgcgtgcacgagctgcacccgcaggtgcgcgacgtgcgctggcggcagggc
gacgacggcgtcacgacggtgcactaccggatccgcgtcgcgcccaaggtgtttgtgtgg
ggcgtcgacgccgacgtcgtctacacggtcgacccgcagccggactcgggggtgccggcg
ctgacggtgcgggcggcgggctcgttccacaacgacacggccgtcgagctgcagacgctc
ccgcgcatcgggctgctggcgtggctccccgcggccctggacgaggtggcgtggttcggg
cgcgggccgcacgagacgtaccgcgacagcaagcaggccggccggttcggcaactggaac
gccaccgtcgacgagctgcgcaccacgtacgactacccgcaggagaacggcaaccgcgag
gacgcgcggtgggtgtcggtgcgcagcagagaggggcgagcggcgctgcgggcgagcatg
gtcgacagcgacggcggcggaaacagccacaacgacgcgcacggcgagacatttgccttt
gccgccgcgaggtacatgcccgaagacctgaaccgcgccaagcacccgcacgaactgagg
aagctggacgtgacggtgctgaacctggactaccgcgggaacgggttggggtcggcgacg
gtcggcccgaggccgttggagcagtacagatgcaagccggagccgtttgactttactttc
aggttggaggtgttgaaagggtga

DBGET integrated database retrieval system