KEGG   Magnaporthe oryzae: MGG_11374Help
Entry
MGG_11374         CDS       T01027                                 

Definition
(RefSeq) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00052  Galactose metabolism
mgr00561  Glycerolipid metabolism
mgr00600  Sphingolipid metabolism
mgr00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MGG_11374
  Lipid metabolism
   00561 Glycerolipid metabolism
    MGG_11374
   00600 Sphingolipid metabolism
    MGG_11374
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    MGG_11374
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MGG_11374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase
Motif
Other DBs
NCBI-GeneID: 5051330
NCBI-ProteinID: XP_003713653
UniProt: G4MTA0
Position
2
AA seq 512 aa AA seqDB search
MTSRRTTIHAAAAATLLLAALPVSAVKNGLAITPPMGWNNWNAFGCDVSEHLLLSTSEAV
VNLGLRDLGYDHVVLDDCWQDPDGRDPNGKLQPNADKFPRGLKAISDDLHSENLKFGMYS
TSGEMTCARFEGSLDHEVDDANSFASWGVDFLKYDNCYNMGRIGSPVATFNRFKVMADAL
NATGRPIQLNLCNWGEDYVHTWGMSIANSWRMSGDIYDSFTRPDDLCSCTDPHDPLCVAP
GTHCSVLFILNKVAPFADKSIPGGWSDLDMLEVGQGGMTREEQRAHFAMWAALKSPLMLG
NDLRSMPAEALAIVSNPAVIALSQDPHGRSVLRVKRTVGGELQPDEFGAQESHVWSGRLQ
NGDQVVILLNAAGNDVEMTASLNDIFVADGPGGSAPQVKYGWAIHDLMASEMPIETAQAL
VDAANDRVQTAAILKKANWYNATETPYAVGLENEDPRLFGEKIGEVEAKGAIKVKVPSHS
AKVYRLRRISKPGDNYKQKSHDRTTREVKEEL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacgccgcacaaccatccacgcagcagcggctgccacgctcctcttggcagcc
ttgccggtaagcgctgtcaagaatgggttggcaatcacaccacccatgggctggaacaac
tggaatgcttttgggtgtgatgtgtcagaacatcttctactgagcaccagcgaagcggtc
gtgaaccttggcctccgagacctcggttacgatcacgtcgtcttggacgactgctggcag
gacccagacggacgggaccctaacggcaagctccagccgaatgccgacaaattcccccgg
ggcctgaaggccatctcggatgacctgcattcggagaatctcaagttcggcatgtactct
acttcgggagagatgacatgtgcacgatttgagggatctctagatcatgaggtcgacgac
gcaaacagcttcgcgtcttggggcgtcgactttttgaagtatgacaactgctacaacatg
ggccgtatcggctcccccgtcgccacattcaaccgcttcaaggtcatggcggatgccttg
aacgcaacgggccgtccgattcagctgaatctttgcaactggggcgaggattacgtacac
acttggggcatgtcgattgccaactcgtggcggatgagcggcgacatctacgacagcttt
acccggcccgatgatctctgcagctgcaccgatcctcacgaccctctctgcgttgcccca
ggcacgcactgctcggtcctcttcatcctgaacaaggttgcaccctttgccgacaagagc
attcctggcgggtggagcgatctcgacatgctggaggtgggccagggcggcatgacacgt
gaggagcaacgtgctcactttgccatgtgggctgcgctcaagtcaccgctcatgttgggc
aacgacctgcgcagcatgccggctgaggcgctggctattgtgagcaatcctgccgttatt
gccttgagccaggatccgcatggccgcagcgttttgcgcgtaaagaggaccgttggcggt
gagctccagcccgacgagtttggcgcccaggagagccacgtctggagcggcagactgcag
aatggcgaccaggtggtgatactcctcaacgctgccggaaacgacgtcgagatgacggcc
agtctcaatgacatcttcgtcgccgacggccccggaggctcggcaccccaggtcaagtat
gggtgggccattcatgatcttatggcaagcgagatgcctatagagacagcccaagccctt
gtcgatgctgccaatgaccgcgtccagacggcagccatcctgaagaaggccaactggtac
aacgccaccgagactccgtatgcagtaggtctggagaatgaagaccccaggctgtttggt
gagaaaatcggggaggtcgaagccaagggcgcgatcaaggtcaaggtgcccagccactcc
gccaaagtctaccgtctgaggaggatctccaagcctggtgacaactacaagcagaagagc
catgacaggacgacgcgggaagttaaggaggagctctaa

DBGET integrated database retrieval system