KEGG   Magnaporthe oryzae: MGG_11447Help
Entry
MGG_11447         CDS       T01027                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mgr  Magnaporthe oryzae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mgr03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 417 aa AA seqDB search
MPEIAEVARVAHFLRLHLVGKKVVKVSAQDDANVFGKVGTTGEAVVAALKNRKVVSVGTQ
GKYFWFVMDKAPHLVMHLGMTGWFHIRGARTAYTNYYKKQNPDEADQWPPKYWRFHLEVQ
DGTAAAFTDARRFGRVRLVDCPGATIRKHSPLVENGPDPVVDADVFTAEYLLAKMRSRRV
PVKALLLDQAVISGVGNWVADEVLFQARLHPEQLSHEFSDEQVARLHGTIRDVCVLACDK
LADSDLFPDDWLFNHRWGKGAASRTGEQARLPGGERLAFLTVGGRTSCYAPELQKKTGSV
PSGIKEEPLVVVGNKKQKAGKIKKADGGKKLNTTQIRVESGGGVQEEEYETTTPKAKARK
RKQDLDGSGDGAPKKAIKKSESKVEAGAVEAGQPLRADPAIDDGRRRSGRLLAKTNG
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatagccgaagtcgccagagtcgcgcacttcctgcgcctgcaccttgtcggc
aagaaagtcgtcaaggtctccgcgcaggatgatgccaatgtttttggaaaagtcgggaca
accggcgaggcagtggttgctgctctgaaaaacagaaaggtagtttctgtagggactcaa
ggaaaatacttctggttcgtcatggacaaggcgccgcatctcgtgatgcacctcggcatg
acaggatggtttcacatccgcggcgcccgcaccgcctacacaaactactacaagaagcaa
aacccagacgaggcagatcagtggccgcccaagtactggcgcttccacctcgaggtccag
gacggcaccgcagcggcttttacggacgcgcgccgcttcggccgagtgcgcctggtcgac
tgccccggtgccaccataagaaaacacagcccgctggtcgagaacgggccggatcccgtc
gtggacgccgacgtcttcacggccgagtacctactagccaagatgcgctcgcgccgcgtc
cccgtcaaggcgctgctcctcgaccaggccgtcatctcaggcgtggggaactgggtggcg
gacgaggtgctgttccaggcgcgactgcacccggagcaactgagccacgagttctcggac
gagcaggtcgccaggctgcacggcaccatccgggacgtctgcgtcttggcgtgcgacaag
ctcgccgactcggacctgttccccgacgactggctgttcaaccaccggtggggcaagggg
gccgcctcgaggaccggcgagcaggcccggcttcccggtggggagaggctcgcgttcctg
acggtcggtgggcggacgagctgctacgcacccgagctgcagaagaagaccgggagcgtg
ccgtctgggatcaaggaggaacccctggtcgtggtgggtaataagaagcagaaggcgggg
aagatcaagaaagctgatggtggcaagaaactcaatacgacccagatcagggtcgagagt
ggtggtggtgtccaggaagaggaatacgaaactacgacacccaaggcaaaagccagaaaa
aggaaacaggatttggacggctcgggggatggtgcgcccaaaaaagctatcaaaaagtct
gagtccaaagttgaggccggagccgtggaggcgggccaaccactacgggccgatcccgcc
attgacgatggccggaggagatcggggcgtttgctagccaagactaatggctga

DBGET integrated database retrieval system