KEGG   Magnaporthe oryzae: MGG_11613Help
Entry
MGG_11613         CDS       T01027                                 

Definition
alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mgr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 628 aa AA seqDB search
MHLLAAAFAALASSAAASYTGNLNYFSPSNNHPSLGISIPKVAARHRLHSRDLSHTAWDP
KTLEFSHGVASGDPAIDSVVIWTRAAPIGAENDNSNVTVESKGTLLETDRWVQASAAPVC
LEWKIAGDPKLEFPVDSGTVFTSSDIDWTVKVIASNLQAFTTYYYQFNICNSDNKSPLGR
TKSLPQRSSSLSSYVRNIRIGVYSCANYAQGLFNAYGNAVNKDSIHYVVHLGDYIYEYEN
GRYGWGDELGRVPKPNKEIVSLYDYRTRIAQYRTDDGLRRSHQQFPWITVWGDQEVGDNA
YKGDIVEMNNSEDSFVKDGGVSADQRKMNAVRAYFEWMPIRQVDMGDDLRVSRKFAFSDM
FDLIMLDTRVYDRSSPDLDSDTDHTNKPKDDASSELMGPTQEEWFQETLKGSSAKWRLIG
SQLAFSHTMVGPNGKVNADAWDAYEANRNRTFETLSDGMGISNNVFLTGETHVSWASDVV
WEGAKPYNSTSGEGAIGVEFAGTAVSASSSVIGQNGTLEAGNAASKMLEGMNPSLQWLES
YYRGYYELDISYADVNAQFFGTPDIRSANGLEISLANFTVQGGENRLQRDPNGKVGGGRV
EAGSLKGGEMMATNMMHDTRTGEWKIMS
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcctcgccgcggcctttgctgcgctcgcgtccagcgccgcagcatcgtacact
ggcaacctcaactacttctccccttcaaacaaccacccttcccttggcatttcgatcccc
aaggtggccgcccgccaccgcttgcacagccgtgacctctcgcacacggcatgggatccc
aagacgctcgagttctcccacggcgtcgcgtcgggcgatccggctatagacagcgtcgtg
atctggacgagagccgccccgatcggcgccgagaacgacaatagcaacgtcaccgtcgag
agcaaaggcacgttgctcgagacggataggtgggttcaggcgagcgccgccccggtctgc
ctcgagtggaagattgccggcgacccgaagctcgagtttccagtcgactcgggcaccgtc
ttcaccagctcagacattgactggaccgtcaaggtgatcgcgagcaacctgcaggccttt
acgacgtactactaccaattcaacatctgcaactcggacaacaagtccccgttgggacga
accaagtcgctcccacaaaggagctcgagcttgagttcgtatgtccgcaacatcaggatc
ggagtgtactcgtgcgcaaactatgcgcaggggctcttcaacgcctacggcaacgccgtc
aacaaggactcgatccactacgtcgtccacctgggcgactacatttacgagtacgaaaac
ggccgttacggctggggcgacgagctgggccgggttcccaagccgaacaaggagatcgtc
agcctgtacgactaccgcacgcgcatcgcgcagtaccggaccgacgacggcctgcgccgc
agccaccagcagttcccctggatcaccgtgtggggcgaccaagaggtcggcgacaacgcg
tacaagggagacatcgtcgagatgaacaacagcgaggactcgttcgtcaaggacggcggc
gtctcggccgaccagcgcaagatgaacgccgtgcgcgcctactttgagtggatgccgatc
cgccaggtcgacatgggtgacgacctccgcgtgagtcgcaagtttgcctttagcgacatg
ttcgacctcatcatgctcgacacgagggtgtacgaccgctccagccccgacctggactcg
gacaccgaccacaccaacaagcccaaggacgacgcgtcgagcgagctcatgggccctacg
caggaggagtggttccaagagactctcaaggggagctcggccaagtggcgactgatcggg
tcgcagctcgcatttagccacaccatggtcgggcccaacggcaaggtcaacgccgacgcg
tgggacgcctacgaggccaaccggaaccgcacctttgagacgctctccgacggcatgggc
atcagcaacaacgtattcctcacgggcgaaacgcacgtctcgtgggcctcggatgtggtt
tgggagggtgccaagccttacaactccacgagtggcgagggtgccatcggcgttgagttc
gccggtaccgccgtgtcggcatcgagtagcgtcatcggtcagaatgggacattggaggcg
gggaatgctgcatcaaagatgttggagggtatgaacccttcgttgcagtggctggagtcg
tattatcgcgggtactatgagctggatatcagctacgccgacgtcaatgcccagttcttt
ggcacgccagacatcaggagtgctaacggactcgagatctctctggccaactttaccgtt
cagggcggggagaacaggttacagagggatcccaacggcaaggttggtggcggtcgggtt
gaggcggggagtctcaagggaggagagatgatggcgacgaatatgatgcacgataccagg
accggcgagtggaagataatgagctga

DBGET integrated database retrieval system