KEGG   Magnaporthe oryzae: MGG_11771Help
Entry
MGG_11771         CDS       T01027                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGG_11771
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MGG_11771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 328 aa AA seqDB search
MSGGWNTIESDAGVFTYLLEELGVKGVQFEELLTLEPESLASLHPVYGVIFLFKYPTDQP
YRAEKPLDGDFDHDAADDGSLFFASQTIQNACGTQALLSVLLNRTADVEVGPALSDFREF
TMPLPAEFRGEALSNSDLIRSVHNSFARSSPFADETSRPADADSEDAFHFIAYTAAGGRL
WELDGLQPAPISHGPCDSTDGEDFANKVMAVLQRRMQRYESSEIRFNLLAMCRDLRLRAA
ELGDVEAAERERRKRREWRFENGLRRHNFVGFAGEVLRGVVAAKVNEGGGEAYDKWVEQA
KQKMMKRIGDRSERKRSAAGGGDVEMAG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtggagggtggaataccatcgagtccgatgcgggcgtcttcacatacctcctcgaa
gagctcggtgtcaagggcgtccagttcgaggagctcctgaccctcgagcctgaatccctg
gcctcgctccaccccgtctacggcgtcatctttctcttcaagtacccgaccgaccaaccg
taccgcgccgagaaacccctcgatggcgactttgaccacgacgctgccgacgacggcagc
ctcttcttcgcgagccagaccatccagaacgcgtgcggcactcaggccctgctctcagtc
ttactcaaccggaccgccgacgtcgaggtcggccctgccctgtcggactttagggagttc
accatgcccttgcccgccgagttccgcggcgaagccctgtccaactcggacctgatccgc
agcgtccacaacagcttcgcgcgctcctcgccctttgccgacgagaccagccggcccgcc
gacgccgactcggaggacgccttccatttcattgcctacaccgccgcgggcggccgcctc
tgggagctcgacggcctgcagcccgcacccatcagccacggaccctgcgacagcaccgac
ggcgaggactttgctaacaaggtcatggccgtgctgcagcgccgcatgcagcgctacgaa
tcctccgagatccgcttcaacctgctcgccatgtgccgggacctgcgcctgcgcgccgcc
gagctgggcgacgtcgaggccgcggagcgtgagcggaggaagcgccgcgagtggcggttc
gagaacggcctgcgcagacacaactttgtaggcttcgccggtgaggttctgcgcggcgtc
gtggccgccaaggtcaacgaaggcggtggcgaggcctatgataagtgggtcgagcaggcg
aagcagaagatgatgaagaggataggggacaggtccgagaggaagaggagtgccgctggc
ggaggcgacgttgagatggctggttga

DBGET integrated database retrieval system