KEGG   Magnaporthe oryzae: MGG_12805Help
Entry
MGG_12805         CDS       T01027                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MGG_12805
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGG_12805
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MGG_12805
Enzymes [BR:mgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MGG_12805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 717 aa AA seqDB search
MEHINQTFERCKARGRPALVTYVTAGYPKAEDTPGIMLAMEQGGADVIELGVPFTDPIAD
GPTIQTANTIALKNRVTLSSTLQMVRDARKQGLKAPVMMMGYYNPLRAYGEAKLLQDCKE
AGVNGFILVDLPPEEAVSFRKLCTVAGLSYVPLIAPATSDARMRLLCQLADSFIYVVSRQ
GVTGATGTLNQALPELVARVKKYSGNRPAAVGFGVSTREHFLSVGGLADGVVVGSQIITT
LAKAEPGKGLEAVREYCSYLCGRASAEDVAEVTVAPAADHSEKAKTGDEVGAKLSGSTAG
QGENDADLVAQLAAMHGKIPDRFGEFGGQYVPESLMDCLSELEEGFNKIIDDPAFWEEYR
SYYPYMGRPGQLHLAERLTEHAGGARIWLKREDLNHTGSHKINNALGQLLLARRLGKTRI
IAETGAGQHGVATATVCAKFGMECTVYMGAEDVRRQALNVFRMRLLGAKVVPVEAGTKTL
RDAVNEAMRSWVVDLDTTHYIIGSAIGPHPFPTIVRTFQSVIGKETKEQMMKLKGKLPDA
VVACVGGGSNAVGMFYPFSNDPSVKLLGVEAAGDGVETLRHSATLSAGTKGVLHGVRTYV
LQDEHGQITDTHSVSAGLDYPGVGPELANWKDSERAKFVNATDAQAFTAFRLISQLEGII
PALESAHGIYGAVELAKTMGKDEDVVICLSGRGDKDVQSVADELPRIGPVIGWDLRF
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaacacatcaaccagacttttgagcggtgcaaggcccgcggcaggccagcgcttgtc
acatatgtcaccgctggctaccccaaggccgaggacacgcccggtattatgttggccatg
gagcagggcggcgccgacgttatcgagctcggtgtccccttcactgaccccattgccgac
ggaccaacaatccagactgccaacactatcgcgctcaagaaccgcgtcaccctttcctca
acacttcagatggtccgtgacgcaagaaagcagggtctgaaggcgcccgtcatgatgatg
ggttactacaacccactccgggcgtacggcgaggcaaagctgctgcaggactgcaaggag
gccggcgtcaacggcttcatcctcgtcgacttgccacctgaggaggcggtttctttccgc
aagctctgcaccgttgctggactctcatacgtacccctgattgcaccagcaacgtccgac
gctcgtatgcgactcctctgccagctcgccgactccttcatctacgtcgtctcacggcag
ggtgttacgggcgcaacgggaaccctcaaccaggcactaccggagctggtggcgcgggta
aagaagtacagtggaaacaggccggcggctgtgggctttggcgtctcgacccgggagcac
ttcctctcggtcggcgggctggcggacggtgtcgtcgtcggcagccaaatcatcacgacg
ctggccaaggccgagcctggcaagggcctggaggcggtgcgggagtactgctcctacctg
tgcgggcgggcttcggccgaggacgtcgctgaggtcacagttgccccggcggcggaccac
agtgagaaggccaagacaggagacgaggtgggcgccaagctctcgggcagcaccgcgggc
cagggcgagaacgacgcggacctggttgcgcagctcgcggccatgcatggcaagatcccc
gaccggttcggcgagtttggcggtcagtacgtgcccgagtcgctcatggactgcctgtcg
gagctggaggagggcttcaacaagatcatcgacgacccggcgttctgggaggagtacagg
tcttactacccttacatgggccgaccgggccagctgcatctcgccgagaggctgacggag
catgccggcggtgcccggatctggctgaagcgtgaggacctgaaccacaccggtagccac
aagattaacaatgcgctcggccagctgctgctcgcacggaggctgggcaagacgcgcatc
attgccgagacgggcgccggtcagcacggtgtcgcgacggcgacggtgtgtgccaaattc
ggcatggagtgcaccgtctacatgggcgccgaggacgtgcggcggcaagccctcaacgtc
ttccgcatgcggcttttgggtgcaaaggttgtcccggtcgaggcgggcaccaagactctc
agagacgcggtcaatgaggccatgaggtcctgggttgtcgaccttgacaccacgcactac
atcatcggttcggccattggaccgcatccgttccccaccattgtgaggacgttccagtcc
gtcattggtaaggagacaaaggagcagatgatgaagctgaagggcaagctgcccgatgca
gtggttgcgtgcgtcggtggcggctccaacgccgtcggcatgttctaccccttcagcaac
gacccgagcgtcaagctgctgggagttgaggcggcgggcgacggtgtcgagactctgagg
cacagtgcaaccctttcggctggcaccaagggcgttcttcacggcgtgaggacgtatgtg
ctgcaggacgagcacggtcagatcaccgacacccactcggtgtcggctggtctcgactac
cctggtgtgggtcctgagctggcaaactggaaggacagcgagagggccaagttcgtcaac
gccacggacgcgcaggcctttacggcctttaggctcatcagccagcttgagggcatcatc
ccggcactcgagtcggcgcacggcatatacggcgccgtcgagttggcaaagacgatgggc
aaggacgaggacgtcgtcatttgcctcagcggacgtggtgacaaggacgtacagagtgtt
gcggatgagttgccaaggattggccccgtcattggatgggacctcaggttttaa

DBGET integrated database retrieval system