KEGG   Magnaporthe oryzae: MGG_12999Help
Entry
MGG_12999         CDS       T01027                                 

Definition
acetoacetate-CoA ligase
Orthology
K01907  
acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
mgr  Magnaporthe oryzae
Pathway
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MGG_12999
Enzymes [BR:mgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     MGG_12999
Lipid biosynthesis proteins [BR:mgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MGG_12999
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 704 aa AA seqDB search
MDPSKMPKKLWEHPDPKSTAMWQFMQRINDKHNAGLKTFRDLHRFSITRRGEFWSSLWDA
AGYIHEGTHDQVVDFDAPIDSVPRWFEGVRLNWAENTLYSRDRGSAPGTRSLTSKEDDKI
AVTEVREGASEIRDITWGELRRQTGELAAALAGRGVKRGDRVVIVGANSIETLLVWLATA
WLGAIFSSSSTDMGVDGILQRTVQINPKVLFMDDAALYNGKVVDLREKMTQVVSGLKKDC
SAFAGAVAIPRFQGHAKDVSKVPNTETWASLHSQTQGAQPPPFTRIPFHEPFLVCYSSGT
TGAPKAIVHTVGGLMLSLYKEGALHEGLGPDSVTLQFTTTGWIMYVTNIGVLVLGARAIL
YDGSPLTPDPTVLIKILSKYKATKLGTSPRWMLELAKRGISPKEVADLSSLKIVLSTGMV
LSDQLFEWFYEKGFPAHTQLANISGGTDIAGCFGIMNPLEPVYIGGTQGPSLGIDVRVYD
ALEPNGPGKEVPHGTPGELVAVNTFPNIPAFFWGDKQTAATSAPPGSKYHGSYFARFDHV
WSHGDFVAVHPMTGGIHFLGRADGVLNPSGVRFGSAEIYGVIERRFADAVVDSLCVGQRR
PQDSDESVMLFLLMRPGHKLDGKLEREVRHAIGEDLSKRHVPKYIFETPEIPTTVNLKKV
ELPVKQIVSGQKIKPSGTLANPKSLDFYYQFAKVEDLVAPKAKL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggacccaagtaagatgcccaagaagctttgggagcatcccgatcccaagagcacggct
atgtggcagtttatgcaacgaatcaacgacaagcacaacgccggcctcaagacattccgc
gacctccaccgcttctccatcacaaggcgaggcgagttttggtcctcgctctgggacgct
gctggctacatccacgagggtacccacgatcaggttgtggactttgatgctcccatagac
tcggttccgcgttggtttgagggcgtgaggctcaactgggccgagaacactctctactcg
agggatcgcggctctgcgccgggcacgaggtctctgacctcaaaggaagatgacaagatc
gccgtcacagaggtccgcgagggcgcgtctgagatccgcgacatcacttggggcgagctg
cgccggcagacgggcgagctagcggcggcgctggccggtcggggcgtcaagcgcggcgac
agagtagtcatcgtgggcgccaacagcatcgagacgctgctagtctggctcgcgacggcg
tggctgggcgccatcttcagcagcagcagcaccgacatgggagtcgacggaatactgcag
cggaccgtgcagatcaaccccaaggttctgttcatggacgacgccgcgctttacaatgga
aaggtcgtcgacctgcgtgagaagatgacgcaggtagtctccgggctcaagaaggattgc
agcgcgtttgcgggcgccgtcgccatccccaggttccagggccacgccaaggatgtcagc
aaagtgcccaacacggagacgtgggccagcctgcactcccagactcagggggctcagccg
ccaccgttcacgaggatccccttccacgagccttttctggtctgctactcatccggcacc
acgggtgctcccaaggccattgtgcacaccgtgggtggcctaatgctcagcctgtacaag
gagggtgcgctgcacgaggggctcggcccggattcggtgacgctgcagttcacgacgacg
gggtggatcatgtacgtgaccaatatcggcgtcttggtcttgggcgccagggccatcttg
tacgatggcagcccgctcacacccgacccgacggtcttgatcaaaattctcagcaagtac
aaggccaccaagctggggacgagtccaaggtggatgctcgagctggccaagagggggatc
tcaccgaaggaagtggccgacttgtcgagtttgaagattgttttatcgactggcatggtc
ttgtcggatcagctgtttgaatggttctacgagaaaggatttcccgcacatacgcagctg
gcgaacatatcgggtggaacagatattgctggttgcttcggtatcatgaaccccctcgaa
ccagtctacatcggcggaacccagggccccagtctcggcatcgacgtgcgcgtgtacgat
gccctggagcccaacgggccgggcaaggaggtgccgcacggcacgccgggcgagctcgtc
gccgtcaacaccttccccaacataccagccttcttctggggcgacaagcagacggcggcc
accagcgccccgccgggctccaagtaccacggctcctactttgcccgcttcgaccacgtc
tggagccacggcgactttgtggccgtgcaccccatgacgggcggcattcacttcctcggc
cgcgccgacggcgtcttgaacccctcgggcgtgcgcttcggctcggcagagatctacggc
gtcattgagcgtcgcttcgctgacgccgtggtggactcgctgtgcgtgggacagcggagg
ccccaagactctgacgagagcgtcatgctcttcctcctcatgaggcccggtcacaagctg
gacgggaaactcgagcgggaggttaggcatgccatcggggaggacttgtccaagagacac
gttcccaagtacatctttgagacgcccgagatcccgacaaccgtcaacctcaaaaaggtc
gagctgccggtcaagcagatcgtctcgggccaaaaaatcaagcccagcgggactctggcg
aaccctaaaagccttgacttctactaccagtttgccaaggtcgaggatctcgttgccccc
aaggcaaagctgtga

DBGET integrated database retrieval system