KEGG   Magnaporthe oryzae: MGG_13163Help
Entry
MGG_13163         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MGG_13163
    1.3.1.94  polyprenol reductase
     MGG_13163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 314 aa AA seqDB search
MGVYDAGLAVLQLLSPAQWVQTFFILAAAAVLALTVLPSRTRRLLLDYGARGGSRQSAAA
AGSDWLENITATVTSWGQIPHSWFAAFYAISLASSAFWAYQFAFQGEILRVIVSTQDASR
SEAMGQSLVAVKVAWALMALQGARRLFEQLFVLRSSTSKMWIIHWALGLSFYISMSVAVW
IEGSGSILDQWSKPNDAHSPGLKVFTGSVMFIIVSVTQFKCHSHLASLKKYSLPTRGLFQ
YTVCAHYTCECLIYISLAIVAAPEGQMFNKTILSAIVFVAVNLGLTAHGTRKWYEAKFGA
EKIAARWTMIPLVY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggggtttacgatgccggccttgccgtcctccagttgctgtccccagcccaatgggta
cagactttcttcatcctagcagcagctgcagtcctcgccctcacagtcttaccttcgcgg
actcgcagactccttcttgactacggcgcccgcggtggctcgagacaaagtgcagctgcg
gctggaagcgactggctggagaacatcaccgccaccgtcacgtcgtggggccagatacca
cactcgtggttcgctgctttttatgcaatatcgctggccagctcagccttttgggcatac
cagtttgcctttcaaggtgaaattctgcgggtgatcgtgtcaacccaggatgctagccgt
tctgaagccatgggccagagcctggtggcggtcaaggtggcatgggctttgatggcacta
cagggagctaggcgactattcgagcagctattcgttctccgatcttcgacttccaagatg
tggatcatccattgggcactcgggctgtctttctacatatccatgagtgttgccgtgtgg
atcgaaggttcaggatccatcctcgaccaatggtcaaaacccaatgacgcccatagccct
ggtctcaaggttttcacaggctctgtcatgttcatcatcgtctcggtgactcagttcaag
tgccacagtcacttggcaagtctcaagaaatactcgctcccaacacgagggctcttccaa
tacacggtttgcgcccactacacctgcgagtgtctcatctacatctcgctggccatcgtg
gcagcaccggaagggcagatgtttaacaaaacaatactgtcggcaattgtatttgtggca
gtcaaccttggcttgacggcacacggcactcgaaaatggtatgaggccaaattcggtgcc
gaaaagatagcggcccgatggaccatgatccctctggtgtactag

DBGET integrated database retrieval system