KEGG   Magnaporthe oryzae: MGG_13801Help
Entry
MGG_13801         CDS       T01027                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
mgr  Magnaporthe oryzae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MGG_13801
  Lipid metabolism
   00600 Sphingolipid metabolism
    MGG_13801
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MGG_13801
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MGG_13801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 920 aa AA seqDB search
MDLACFYTGRAPRVLSDSFWTPFHSLFSWPALCPWQDLPLPPVYARGQAREERNKADKMG
RLTSALLLGLALFSGDAAAAEQRSRESLNAGWRFSRFTSNPDGLTYSSLKPFILPAANDF
VVDPAKHAQRPAQGSEPAAPEFSKAEFDDGSWEALNLPHDWAIKGPFYEGPDPPVGGGQG
RLPSQGIGWYRRNLDFAPEDAGKAVYIEIDGAMSYSTVWLNGRIVGGWPYGYASYRLELT
PFLKEGKNQLAIRVDSPIDVSRWYPGGGVYRNVWLTKVNPTHVGHWGTYIKTKDVSSESA
TVDLAVTLESTSKQESKVVVTTDVHVLDASGQPGAKVASFGNATVTVPAGSSSSTNGTVT
ISNPALWGPKPDQTPNLHVAVTSVYSSDGELLDTYKTNFGIRNLQYTNDGLHVNGKRVYL
QGVCQHHDLGSLGSAFHVPAARRQLEMLQDMGSNAVRTSHNPPAPELLELADHMGMLVLD
EIFDTWSIHKVENDFASIWDDWSEPDLRAFVRRDRNHASVWAWSYGNEVREQLTDGGERT
AQRLAGIAHEEDATRSSSVGMNNAGPGSPFTAVVDLIGLNYQGEGKTGTRPSFPNFRSIY
PNKMIYSTESSSVVSSRGTYVFPVPSENSAVVNITTAVGVINDTRQVSSYELHGVEWGAS
PDKVFAGQDEFPYVGGEFVWTGWDYIGEPTPYDDESRSSYFGIIDLAGFPKDRFYLYQAR
WAAAKPMAHILPHWNWAGREGQVTPVHVFSSGDEAELFINGKSQGRKTRGQLEYRFRWDD
VAYAPGEVHVATYKGGAPWANATVRTTGAPTTLSLSSYKEQKTLRADGSDLAFLSVAVTD
DQGDVVPTAEPEVRFSVSGPAEIVSTDNGNPTDFVPFPSHTRKAFRAKALAIVRAKEGAG
RIVVTAEADGLKKGEFVLNA
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggatttggcgtgtttttataccggtcgagccccccgggtcttgtccgactccttttgg
accccctttcactctctattctcatggccggccctctgtccctggcaagaccttcctctc
cctcctgtgtacgctagaggacaagcaagagaagagagaaacaaagcagacaagatgggt
cgattaacaagcgccctcctcctcggcctggcgctcttctcgggcgacgccgccgcggcg
gagcagcggtcgcgagagagcctcaatgccggctggcgcttcagccgcttcacgtccaac
ccggacgggctgacctactcgtcgctcaagcccttcatcctgccggcggccaacgacttt
gtcgtggacccggccaagcacgcccagcggcccgcgcagggctcggagccggcggcgccc
gagttctccaaggccgagtttgacgacggctcctgggaggccctgaacctgccccacgac
tgggccatcaagggccccttttacgagggccccgaccctcccgtgggtggcggccagggg
aggctgcccagccagggcatcggctggtacaggcggaacctggactttgcgcccgaggac
gccggcaaggccgtctacatcgagatcgacggcgccatgagctactcgaccgtctggctg
aacggcaggatcgtgggtggttggccgtacggctatgctagctaccggctggagcttacc
cccttcctcaaggagggcaagaaccagcttgccatcagggttgactcgcctattgacgtg
tctcggtggtacccgggtgggggtgtctacagaaatgtctggctcaccaaggtcaacccc
acgcacgtcggccactggggaacttacatcaagaccaaggatgtctcttcagagtctgct
acggtagatcttgccgtcaccttggagagcacaagcaagcaagaatccaaggtcgtcgtc
acgacagacgtccatgtcctggatgcctctggtcagcccggggccaaggtggcgtcgttt
ggtaatgccactgtcactgtccctgctggctcatccagctcgaccaacggcactgtgacc
atctcaaacccggccctttggggacccaagccagatcagactcccaacctccacgtcgct
gtcacgagcgtctactctagcgatggggagctcctcgacacttacaagaccaactttggt
atccgcaacctgcagtacaccaacgacggactccacgtcaacggcaagcgcgtctacctt
cagggcgtttgccagcaccacgatctgggcagcttgggctcggccttccacgtgccggcg
gcgaggcgccagctcgagatgctccaggacatgggcagcaacgcggtgcggacatcgcac
aaccctccggcgcccgagctcctggagctggccgaccatatgggcatgctggttctcgac
gagatctttgacacgtggtctatccacaaggtggaaaacgactttgcctccatctgggac
gactggtcggagccggacctgcgcgcctttgtgcgccgcgaccgcaaccacgcctcggtc
tgggcatggagctacggcaacgaggtgcgggagcagcttaccgatggcggcgaacgtacc
gcgcagcggctggcgggcatcgcgcacgaggaggatgccacgcgctccagcagcgtgggc
atgaacaatgccggccccggctcgccgttcacggccgtcgtggacctcatcgggctcaac
taccagggcgagggcaagacgggcacgcgcccttcgttccccaacttccgctccatctac
cccaacaagatgatctactcgaccgagtcttcgtcggtcgtctcctcccgcggcacgtac
gtgttccccgttccgtctgagaactcggccgtcgtcaacatcaccacggccgtgggcgtc
atcaacgacacgcgccaagtgtcgagctacgagctgcacggcgtggaatggggcgccagc
ccggacaaggtctttgcggggcaggacgagttcccctacgtggggggcgagttcgtctgg
acggggtgggactacattggcgagccgacgccgtacgacgacgagtcgcgctcgtcctac
tttggcatcatcgacctcgccggcttccccaaggaccgcttctacctgtaccaggcgcgg
tgggcggcggccaagcccatggcgcacatcctgccgcactggaactgggccggccgcgag
ggccaggtgacgcccgtgcacgtcttctcgtcgggcgacgaggcggagctctttatcaac
ggcaagagccaaggccgcaagacgcgcgggcagctcgagtaccgcttccgctgggacgac
gtcgcgtacgcgcccggcgaggtccacgtcgccacctacaagggcggcgcgccctgggcc
aacgccacggtgcgcacgacgggcgcgcccaccacgctctccctctccagctacaaggag
caaaagacgctgcgggccgacgggagcgacctcgccttcctcagcgtcgccgtcacggac
gaccagggcgacgtggtgccgacggcggagcccgaggtcaggttctccgtctcgggcccc
gccgagatcgtgtccaccgacaacggcaaccccaccgactttgtgcccttccccagccac
accaggaaggcgttccgggccaaggcgctggccatcgtcagggccaaggagggcgcaggg
cgcatcgtggtgacggccgaggcggatgggttgaagaagggcgagtttgtgctgaatgct
tga

DBGET integrated database retrieval system