KEGG   Magnaporthe oryzae: MGG_13915Help
Entry
MGG_13915         CDS       T01027                                 

Definition
STAM-binding protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mgr  Magnaporthe oryzae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MGG_13915
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MGG_13915
Peptidases [BR:mgr01002]
 Metallo Peptidases
  Family M67
   MGG_13915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 563 aa AA seqDB search
MEARTMPRPRRPPLTIAQIVEQADQFEFNINIHLKHWVGAAETLYREGEFYKEEGNFAKA
YLLLLRHCSLVLKKFPEHPMAHTRDGRKLIKPLQERLTRIISELEDLKRHINEAYNEWER
LVRTGQIDDRPVPDSRYDKYAAQDPALSWNNATQAQLLDAGNNQELAVRLAKDDYIRRDA
ARRSIRQAGVSEYEEQIRRSGGVWEDWDARRGMGPRNTVDDRNDIQRQIQETRRRLDRSN
DQDSEVVVRDFSYNDSWSSSAGSRSSRPPIQNPASQHYNYPSVSRPRPLNYNSYEASPAP
SRPPKEQYPSYQDRLEPLPPPIPRKAPEAGRAPPTLPPKTLDQPEERNVQNSTSSVDRAV
NELSKRKNITFLPAGYTEAGKPLRPIFVPRSLKDKFLEIAGPNTRKGLELCGIICGRPIN
NALFVAALLIPNQICTSDTCETEDEFQIFEFCEKENMIIIGWIHTHPTQTCFMSSRDLHT
HASYQAISPESVAIVCAPKYNDFGVFRLTDPPGLPHVLRCPHTNTFHQHELPESEIYKDA
LHPVSHVYMSDQIDFDVTDLRPK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcgcacaatgccgcgtccgcgccggccgccattgacgattgcccaaatcgtg
gagcaggcagaccagttcgagtttaatatcaacatccacttgaaacactgggtcggtgca
gccgagactctgtaccgtgagggcgagttttacaaagaagaaggcaactttgccaaagcc
taccttctactgcttcgccactgctccctcgtgctcaaaaagtttcccgaacacccaatg
gcccacactcgcgacggtcgcaagctgatcaagcccctccaagaacgactgacccgcatc
atctcggagctggaagatctcaagaggcatatcaacgaggcgtacaacgaatgggaaaga
ctggttaggacggggcaaatcgatgaccgacccgttcccgatagcaggtacgacaagtac
gccgcccaggacccggcgctgtcatggaacaacgctacccaagcccagttgctggatgct
gggaacaaccaggagctggctgtacgccttgccaaggatgattacatccggcgcgacgcg
gctaggcgctcgattcgtcaggcaggggtgtcagaatatgaggagcaaatccgccgcagc
ggaggtgtctgggaggactgggatgcccgtaggggaatgggcccacgtaatacggtagac
gatcgaaacgatatacaacggcagattcaggagacacgaaggaggctggataggtccaac
gaccaagattcggaagttgtggtacgagactttagttataatgacagctggtcatcaagt
gcaggttcgaggtcatcgcgaccgcctatccagaacccggcctcccagcactacaactat
ccgtcagtctcgagaccgagaccgttaaactacaactcatacgaggcatcaccagcccct
tccagaccaccaaaggagcaatacccgagctatcaagacaggttggagcccctgccacct
ccaataccacgaaaggctcctgaagcagggcgtgcccctcctactctcccgcccaagact
ctggaccagccagaggagaggaacgttcaaaactcgacatcgtctgttgaccgggcggtg
aatgagctttccaagcggaagaacatcacattccttcctgctggatacacagaagccggg
aaacctctgcgacccatctttgttccgcgctccctcaaggacaaattcctcgaaatagcc
ggccccaacactaggaaagggctggagctttgcggcatcatctgtggaaggccgattaat
aacgcgctctttgtagctgctctgcttattcccaaccagatatgtacttcggacacatgc
gagacggaggacgagttccagatctttgagttttgcgaaaaggagaacatgatcataatt
ggctggatacatacgcatccgacgcagacgtgttttatgagctcgagggacttgcacacc
cacgcgagctaccaggccatttctcctgagtcggtggcaattgtctgcgcacccaagtac
aacgattttggggttttccgcttgacagaccctccaggccttccgcacgtgttgcggtgt
ccccatacgaatacgttccaccagcacgaactgccagagagcgaaatctacaaggatgct
ctgcacccagtcagccatgtgtacatgtcggatcaaatagattttgatgtcacggacctg
cggccgaagtga

DBGET integrated database retrieval system