KEGG   Magnaporthe oryzae: MGG_13915Help
Entry
MGG_13915         CDS       T01027                                 

Definition
STAM-binding protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
mgr  Magnaporthe oryzae
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mgr04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 563 aa AA seqDB search
MEARTMPRPRRPPLTIAQIVEQADQFEFNINIHLKHWVGAAETLYREGEFYKEEGNFAKA
YLLLLRHCSLVLKKFPEHPMAHTRDGRKLIKPLQERLTRIISELEDLKRHINEAYNEWER
LVRTGQIDDRPVPDSRYDKYAAQDPALSWNNATQAQLLDAGNNQELAVRLAKDDYIRRDA
ARRSIRQAGVSEYEEQIRRSGGVWEDWDARRGMGPRNTVDDRNDIQRQIQETRRRLDRSN
DQDSEVVVRDFSYNDSWSSSAGSRSSRPPIQNPASQHYNYPSVSRPRPLNYNSYEASPAP
SRPPKEQYPSYQDRLEPLPPPIPRKAPEAGRAPPTLPPKTLDQPEERNVQNSTSSVDRAV
NELSKRKNITFLPAGYTEAGKPLRPIFVPRSLKDKFLEIAGPNTRKGLELCGIICGRPIN
NALFVAALLIPNQICTSDTCETEDEFQIFEFCEKENMIIIGWIHTHPTQTCFMSSRDLHT
HASYQAISPESVAIVCAPKYNDFGVFRLTDPPGLPHVLRCPHTNTFHQHELPESEIYKDA
LHPVSHVYMSDQIDFDVTDLRPK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcgcacaatgccgcgtccgcgccggccgccattgacgattgcccaaatcgtg
gagcaggcagaccagttcgagtttaatatcaacatccacttgaaacactgggtcggtgca
gccgagactctgtaccgtgagggcgagttttacaaagaagaaggcaactttgccaaagcc
taccttctactgcttcgccactgctccctcgtgctcaaaaagtttcccgaacacccaatg
gcccacactcgcgacggtcgcaagctgatcaagcccctccaagaacgactgacccgcatc
atctcggagctggaagatctcaagaggcatatcaacgaggcgtacaacgaatgggaaaga
ctggttaggacggggcaaatcgatgaccgacccgttcccgatagcaggtacgacaagtac
gccgcccaggacccggcgctgtcatggaacaacgctacccaagcccagttgctggatgct
gggaacaaccaggagctggctgtacgccttgccaaggatgattacatccggcgcgacgcg
gctaggcgctcgattcgtcaggcaggggtgtcagaatatgaggagcaaatccgccgcagc
ggaggtgtctgggaggactgggatgcccgtaggggaatgggcccacgtaatacggtagac
gatcgaaacgatatacaacggcagattcaggagacacgaaggaggctggataggtccaac
gaccaagattcggaagttgtggtacgagactttagttataatgacagctggtcatcaagt
gcaggttcgaggtcatcgcgaccgcctatccagaacccggcctcccagcactacaactat
ccgtcagtctcgagaccgagaccgttaaactacaactcatacgaggcatcaccagcccct
tccagaccaccaaaggagcaatacccgagctatcaagacaggttggagcccctgccacct
ccaataccacgaaaggctcctgaagcagggcgtgcccctcctactctcccgcccaagact
ctggaccagccagaggagaggaacgttcaaaactcgacatcgtctgttgaccgggcggtg
aatgagctttccaagcggaagaacatcacattccttcctgctggatacacagaagccggg
aaacctctgcgacccatctttgttccgcgctccctcaaggacaaattcctcgaaatagcc
ggccccaacactaggaaagggctggagctttgcggcatcatctgtggaaggccgattaat
aacgcgctctttgtagctgctctgcttattcccaaccagatatgtacttcggacacatgc
gagacggaggacgagttccagatctttgagttttgcgaaaaggagaacatgatcataatt
ggctggatacatacgcatccgacgcagacgtgttttatgagctcgagggacttgcacacc
cacgcgagctaccaggccatttctcctgagtcggtggcaattgtctgcgcacccaagtac
aacgattttggggttttccgcttgacagaccctccaggccttccgcacgtgttgcggtgt
ccccatacgaatacgttccaccagcacgaactgccagagagcgaaatctacaaggatgct
ctgcacccagtcagccatgtgtacatgtcggatcaaatagattttgatgtcacggacctg
cggccgaagtga

DBGET integrated database retrieval system