KEGG   Magnaporthe oryzae: MGG_14602Help
Entry
MGG_14602         CDS       T01027                                 

Definition
endo-1,6-beta-D-glucanase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
mgr  Magnaporthe oryzae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MGG_14602
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MGG_14602
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     MGG_14602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 488 aa AA seqDB search
MLKNSILFCLWQAANFYYCVDAVNVPRKEGPAQAFASSADGKLKFTKIDAPVLGPGNPGS
GATWNLTMDDSTTGAKQTVTGFGGSVTDATVVAYNMLPADKKAELLRKLMTGDGANFSLI
RHSIGSSDLSPAPEYTYDDNNGQEDVELRSFQLGKSGTDMVSMLKEMKALQPSMILVGTS
WAPPAWMQLDRKLVGTTDKNNLDHKYEAQFGQLFVKYLQAYKRGGVDVDAITIQNEPLNS
NAGMPSLYVFPEESGKLIKDHVGPAISKARFSTQVWAYDHNTDRPDYPQTVLDIAREFVP
AVAWHCYAPGENWSALTTFHKRNPSVKQFQTECWTSAKQTKWNQASWFTMGPLQNWASGS
MAWTLGTDNQDGPHLPYEGSCATCTGLFTVDANSKTYTLRTDYYMIGQYSRYIPRNAVVH
VVTGSYSWPDDTGVESVATVNPDGSRTVVIENKLEDDVHVTLHTVKSSQVWSGKVSAKSV
TTWLLPPA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaattcgattctgttctgcctttggcaggcagcaaatttctattactgcgtt
gatgccgtcaacgtgcctcgaaaagaaggaccagctcaggctttcgcgtcttctgccgac
gggaaattgaagtttacaaagatagatgcaccggtgctgggtcccggaaacccaggctcc
ggagcgacatggaatctcaccatggacgacagtacgaccggtgccaagcagacagtcacg
ggctttggtggctccgttactgatgccactgtcgttgcttacaatatgctacccgccgac
aagaaagccgagctactccgaaagttgatgacaggagatggcgccaactttagcctcatc
cggcattcgataggatcttccgatctctcgccagcccctgaatacacctatgatgacaac
aacggccaagaggatgtcgagctgcgaagctttcagctggggaaaagtggaacagacatg
gtatccatgctcaaggagatgaaggctttgcagccatccatgatccttgtcggaacttcg
tgggcaccgccggcatggatgcagctagatcgcaaactggtcgggacgaccgacaagaac
aaccttgaccacaaatacgaggctcagtttggtcaactctttgtcaaatacttgcaggca
tacaaaaggggcggcgtggatgtcgatgccattacaatccaaaacgaacccctcaacagc
aatgccggcatgcccagtctttatgtctttcccgaggaatctgggaagctgatcaaggac
cacgtcggacccgcaatcagcaaggccaggttcagcactcaggtgtgggcatatgaccac
aacaccgacaggccagactacccccagacggtactcgacattgcccgcgagtttgtccct
gctgttgcctggcactgctatgcgcctggcgagaactggtctgcgcttacaacctttcac
aagcgtaacccgtcagtcaagcaattccagaccgagtgttggacgtctgcaaagcaaaca
aaatggaaccaggcctcttggttcaccatgggcccgctgcagaactgggcatcgggctcg
atggcatggacgctcggcaccgacaaccaggacggcccccacttgccctatgaagggtcg
tgcgcaacctgcacgggtttgttcacggtagacgcgaactcgaaaacctacaccctcagg
acggactactacatgattgggcaatacagcaggtacatcccaaggaatgccgtggtgcac
gtcgttacgggcagctacagctggcccgacgacaccggggtggagagtgtggcgacggtc
aacccggacggctctcgaacggtggtgatcgagaacaagctagaggatgacgttcatgtc
acgctccacaccgtgaagagcagtcaggtctggagtggaaaggtttcagcgaaaagtgtt
actacctggctcctgcccccggcctag

DBGET integrated database retrieval system