KEGG   Mycoplasma gallisepticum NC95_13295-2-2P: HFMG95NCA_4438Help
Entry
HFMG95NCA_4438    CDS       T02201                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgs  Mycoplasma gallisepticum NC95_13295-2-2P
Pathway
mgs00010  Glycolysis / Gluconeogenesis
mgs00051  Fructose and mannose metabolism
mgs01100  Metabolic pathways
mgs01110  Biosynthesis of secondary metabolites
mgs01120  Microbial metabolism in diverse environments
mgs01130  Biosynthesis of antibiotics
mgs01200  Carbon metabolism
mgs01230  Biosynthesis of amino acids
Module
mgs_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG95NCA_4438 (tpiA)
   00051 Fructose and mannose metabolism
    HFMG95NCA_4438 (tpiA)
   00562 Inositol phosphate metabolism
    HFMG95NCA_4438 (tpiA)
Enzymes [BR:mgs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HFMG95NCA_4438 (tpiA)
Exosome [BR:mgs04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HFMG95NCA_4438 (tpiA)
  Exosomal proteins of bladder cancer cells
   HFMG95NCA_4438 (tpiA)
  Exosomal proteins of melanoma cells
   HFMG95NCA_4438 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CO_dh
Motif
Other DBs
NCBI-ProteinID: AFP76918
Position
complement(753524..754282)
Genome map
AA seq 252 aa AA seqDB search
MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVAPVFVHLGLANQLKRNE
CLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRKLFHESDELINQKVKTLLE
NKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSLLKDLIIAYEPVWAIGTGKTA
SSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTPDNVSELLAQKDINGALVGGASL
DPHKFIQLIEAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatgaaaagatacatctttggaaattgaaaaacatataaaactactcaagaa
gttaaagagttttttagtgttttaaatcaaactaagttaaccaaaaacccagacgtggtt
tttggtgttgcaccagtattcgtacatttgggtttggctaatcaattaaaaagaaacgaa
tgtttagttttagctcaagatgctaattatgtaatgaataaagctaacacgggaaccgtt
agttatgaacaattaaaagatattggtgttaattacgtaataattggtcactctgaacga
agaaaattatttcatgaatctgatgaactaattaatcagaaagtaaaaacgctattagaa
aataagatgagaccaattttatgtattggtgaaacgttagaagaatacgaagctaacaag
accaaagctgtacttaaagatcagttagaaaaagatcttaaaggaattgatagttcttta
ttaaaagatctaattattgcttatgaaccagtttgggcgatcggaacaggtaagactgct
tcaagtcaaactgcgcaagatgcaatcgcttatattcgaactgttctaggtttattatca
tcaaaaacgatcgcaaatgagttaccaattttatatggtggatcagttactcctgataat
gtttcagaactgttagcacaaaaagacattaatggagcactagtgggtggagcttcatta
gacccacacaaatttatccaacttattgaagctaaataa

DBGET integrated database retrieval system