KEGG   Mycoplasma gallisepticum NY01_2001.047-5-1P: HFMG01NYA_0093Help
Entry
HFMG01NYA_0093    CDS       T02202                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mgt  Mycoplasma gallisepticum NY01_2001.047-5-1P
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HFMG01NYA_0093 (glpK)
Enzymes [BR:mgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HFMG01NYA_0093 (glpK)
Exosome [BR:mgt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HFMG01NYA_0093 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(15180..16706)
Genome map
AA seq 508 aa AA seqDB search
MDKKKYIITLDEGTTSCRSIVFDKQAKIVSVAQNEFTQYFPQSGWVEHDPLEIWNTQLST
MQSVKNKAQIKSVNVEAVGITNQRETVVLWNKETGLPVYNAIVWQDRRTSEYCETLTKHV
DKVREKTGLIINPYFSGTKIRWILKNVPLAQKTLKAGKLLAGTIDSWLIWKLTGGKVHAT
DVSNASRTLLFNIHTMDWDQELLDLFEIPRSILPEVKSSSEVYGYVEPSLWSQRATAKVP
ITGVAGDQQSALFGQLCLKPGMVKNTYGTGCFTLMNIGEEPIMSKNKLLTTVAWKLGKKK
PVYALEGSVFIAGAAVQWIRDGLRLIYDAAESDFYANLASKQDTHQIYLVPSFTGLGAPY
WDSYSRGAIFGLERGTKKEHIIKATLESIVFQTNDLIKAMSSDVDKKIEVVKVDGGATRS
EYIMQFQSSISGVNVIRPKNIESTALGATFLAGLAVGYWKDLKELEKLVKVDKEFKPKLD
KEKVEKLVHGWNVAVKRTFNWMKEVDLK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggacaagaagaaatacattattacattagacgaaggaactacatcttgtcgttcaatc
gtttttgataaacaagctaagatcgtaagtgttgcacaaaacgaatttacgcaatacttt
ccacaaagtggatgagttgagcatgatccattagaaatttggaatacccaactatctaca
atgcaatcggttaaaaacaaagctcaaattaaatcagtaaacgttgaggctgttggtatt
actaatcaacgtgaaactgttgttttatgaaataaagaaacgggacttccggtttataat
gcaattgtatgacaagaccgtagaacaagtgaatattgcgaaaccctaactaaacacgtt
gataaagttagagaaaaaactggtttaatcattaatccttatttctcaggtactaagatt
cgttgaatcttaaaaaatgttcctttagcgcaaaaaactttaaaagctggcaagttacta
gcaggaacaattgattcatgattaatttgaaaactaactggtggtaaggtacacgcaact
gatgtctcaaacgcatcaagaacattattatttaatattcacaccatggattgggatcaa
gaattattagatttatttgaaatccctcggtcgattcttccagaagttaaatcttcttct
gaagtatatggttatgtagaacctagcttatgatctcaacgagctactgctaaggttcca
attacaggtgttgctggtgaccaacaatctgctttatttggtcagttgtgtcttaaacct
ggaatggttaaaaacacctatggaacaggttgcttcaccttaatgaacattggcgaagaa
ccaattatgtctaagaacaaactgttaacaacggttgcttggaaactaggtaagaaaaaa
ccagtttatgcccttgaaggttctgtgtttattgctggagctgctgtccaatgaatacgt
gacggactaagattaatttatgatgcagctgaatctgatttttatgctaatttagcttct
aaacaagacactcaccaaatttatttagttccttcatttactggattaggtgctccttat
tgggactcttattcacgtggagcaatctttggtcttgaacgtggaactaaaaaagaacat
attattaaagcaacacttgaatcgattgtgttccaaactaatgatctgattaaagctatg
tcttctgatgttgataaaaagatcgaagttgttaaagttgatggtggtgcaactagatct
gaatacatcatgcaattccaatcatcaatctcaggggttaatgtaattagacctaagaat
attgaatcaaccgcattaggggcaaccttcttagctggtttagctgttggttattgaaaa
gatctaaaagagcttgaaaaactagttaaagtcgataaagagttcaaacctaaactagat
aaagaaaaagttgaaaaattagttcatggttgaaatgttgcggtaaaaagaacatttaat
tgaatgaaagaggtggatcttaaataa

DBGET integrated database retrieval system