KEGG   Mycoplasma gallisepticum NY01_2001.047-5-1P: HFMG01NYA_3654Help
Entry
HFMG01NYA_3654    CDS       T02202                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgt  Mycoplasma gallisepticum NY01_2001.047-5-1P
Pathway
mgt00010  Glycolysis / Gluconeogenesis
mgt00030  Pentose phosphate pathway
mgt00051  Fructose and mannose metabolism
mgt00680  Methane metabolism
mgt01100  Metabolic pathways
mgt01110  Biosynthesis of secondary metabolites
mgt01120  Microbial metabolism in diverse environments
mgt01130  Biosynthesis of antibiotics
mgt01200  Carbon metabolism
mgt01230  Biosynthesis of amino acids
mgt03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG01NYA_3654 (pfkA)
   00030 Pentose phosphate pathway
    HFMG01NYA_3654 (pfkA)
   00051 Fructose and mannose metabolism
    HFMG01NYA_3654 (pfkA)
   00052 Galactose metabolism
    HFMG01NYA_3654 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HFMG01NYA_3654 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HFMG01NYA_3654 (pfkA)
Enzymes [BR:mgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HFMG01NYA_3654 (pfkA)
Protein phosphatases and associated proteins [BR:mgt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HFMG01NYA_3654 (pfkA)
Messenger RNA biogenesis [BR:mgt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HFMG01NYA_3654 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 DAGK_cat Glycos_transf_1 LYTB
Motif
Other DBs
NCBI-ProteinID: AFP78337
Position
complement(622611..623609)
Genome map
AA seq 332 aa AA seqDB search
MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEGYKGLVEDQIVLANQQE
VIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLVVIGGDGSYQGAKLLSEMG
INVIAMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIISTSVSHNRVSISEVMGRHCGDL
AVYAALATKADLVITPENIKTTQEIVDLAAKRMLQDHKRTFTVIVCEHIYGEDGRDSLKT
IAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAMKFAIKAFECINEQRYGVVLGLSGD
EIVAYNFQEALNKRNPSRIKLINLSNRINGGF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccattcaaacacaacgaattgcgatcttaacttctggaggagattctccaggaatg
aatccagcaatttatgggttagttcaacaagcaatcattaataatattcaaccttactta
gtttatgaaggttataaaggcttagttgaagatcagatcgttcttgctaaccaacaagaa
gtgatcgaccatttctttgattcgggaacgtttatttattcagcaagattagttgaattc
aaagatcttgaagtaagaaaaaaagcagtaagtaaccttaaagcaaaaaaaatcgatacg
ttagtagtgatcggtggtgatggttcatatcaaggcgcaaaactattatctgagatgggg
attaatgtgattgcgatgcctggaacgattgataatgatgtatcttcatcagattacaca
atcggtttttattcagcattagaacatattactagaacgattcaagagatcatctcaact
agtgtttctcacaaccgggtatcgatctctgaagtgatgggacgccattgtggggattta
gctgtttatgcagcacttgcaactaaagctgatctagtaattaccccagaaaatatcaaa
acaacccaagagatcgtagatcttgctgctaaaagaatgttacaagatcacaaacgcacg
tttactgtgatcgtttgtgaacatatttatggtgaagatggcagggatagtttaaaaacg
atcgcccaacagattaatgatcagttaggaattaaaactaatcttaatatcttaacctac
ggtcaacgtggtcaagttcccacaccgatggaacggattctagccatgaaatttgcgatc
aaagcgtttgaatgtattaacgaacaaagatacggcgttgttttaggtttaagcggtgat
gagatcgtagcttacaatttccaagaagcattaaataaacgtaatccttcaagaatcaaa
ttaattaatttaagcaatagaataaacggtggtttttaa

DBGET integrated database retrieval system