KEGG   Mycoplasma gallisepticum NY01_2001.047-5-1P: HFMG01NYA_3671Help
Entry
HFMG01NYA_3671    CDS       T02202                                 

Gene name
aceF
Definition
pyruvate dehydrogenase complex component dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgt  Mycoplasma gallisepticum NY01_2001.047-5-1P
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFMG01NYA_3671 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG01NYA_3671 (aceF)
   00020 Citrate cycle (TCA cycle)
    HFMG01NYA_3671 (aceF)
   00620 Pyruvate metabolism
    HFMG01NYA_3671 (aceF)
Enzymes [BR:mgt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HFMG01NYA_3671 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(626103..627431)
Genome map
AA seq 442 aa AA seqDB search
MFEYKFTDVGEGLHEGVVAQIYVKVGDTIKEGDPMFSVETDKVTTDLPAPEGGKVTAILA
SVGQTVHVGEVMLVLNGDGSSAPAAAPAPAAAPATPAFVAPTPAVTPAPAPTEAAPSGGG
ASVVGEVKVSNTLFGLFGDQRAASTLTPAPATAFAPTPAPVATPLAQAVASDLNVNLHNV
TPANGAKVFSSDVFASAQQSSLAASVAANDNETYKEITSIRKAIAKAMTTAHEEIPATVL
TFNFDVTKLVSYRKQVKDAVLASYNVKLSFLPFLLKAITKAVVAHPVFNSHYDKASNRLV
LKKKINLGIAVDTADGLMVPNIKSAQDKSVIELAREVNNLAEKARSKKIGLADLADGTIS
VTNFGSIGALFGTPIIKFPEVAIIATGTIEEKLARTPENQIVIKQIMPITIAADHRWIDG
ADIGRFAKTLKEIVENLDGLLI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatataaatttacagacgttggtgaagggctacacgaaggtgttgttgctcaa
atctatgttaaagtaggtgacacaattaaagaaggcgacccaatgttttcagtcgaaact
gataaggttacaactgacttaccagctcctgaaggtggaaaagttactgcgatccttgca
tcagtaggacaaactgttcacgttggtgaagtaatgcttgttttaaacggtgatggttca
tcagctccagctgctgcgccagctccagctgctgcgcctgctactccagcttttgtagct
cctactccagctgttacaccagctcctgctcctactgaagctgctcctagtggtggtggt
gcttcagttgtaggtgaagttaaagtttcaaacactttatttggattatttggtgatcaa
cgcgctgcaagcactctaacaccagctcctgctacagcttttgcgccaactccagctcca
gttgcgactcctttagctcaagctgttgctagtgatttaaatgtaaatttacacaacgta
acacctgctaacggtgctaaagtattctcaagcgatgtatttgcatcagctcaacaaagt
tcactagctgctagtgtagctgcaaacgataacgaaacttacaaagaaattacatcaatt
agaaaagcaattgctaaagcaatgactactgctcacgaagaaattccagcaactgtttta
acattcaactttgatgtaactaaattagtatcataccgtaagcaagttaaggatgctgta
ttagcaagttacaatgttaaattatcattcttaccattcttattaaaagcaattactaaa
gctgtagttgctcacccagttttcaactctcactacgacaaagctagcaaccgcttagta
ttaaagaaaaagattaacttaggtattgctgttgatactgctgatggtttaatggttcct
aacattaaatcagctcaagacaaatcagtgattgaacttgctagagaagtaaacaattta
gctgaaaaagctcgctctaagaagatcggtttagctgatttagctgatggtacaatcagt
gtaactaactttggttcaatcggggctttatttggtacaccaattattaaattcccagaa
gttgcaattattgctactggtacaatagaagaaaaattagcaagaactcctgaaaaccaa
atcgtaattaagcaaattatgccaattacaattgcagctgaccacagatgaatcgatggt
gctgatatcggtagatttgctaaaacattaaaagaaatcgttgaaaatcttgacggttta
ctaatttaa

DBGET integrated database retrieval system