KEGG   Mycoplasma genitalium M2288: CM5_00195Help
Entry
CM5_00195         CDS       T02208                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mgu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(44747..46273)
Genome map
AA seq 508 aa AA seqDB search
MDLKKQYIIALDEGTSSCRSIVFDHNLNQIAIAQNEFNTFFPNSGWVEQDPLEIWSAQLA
TMQSAKNKAQIKSHEVIAVGITNQRETIVLWNKENGLPVYNAIVWQDQRTAALCQKFNED
KLIQTKVKQKTGLPINPYFSATKIAWILKNVPLAKKLMEQKKLLFGTIDSWLIWKLTNGK
MHVTDVSNASRTLLFDIVKMEWSKELCDLFEVPVSILPKVLSSNAYFGDIETNHWSSNAK
GIVPIRAVLGDQQAALFGQLCTEPGMVKNTYGTGCFALMNIGDKPTLSKHNLLTTVAWQL
ENHPPVYALEGSVFVAGAAIKWLRDALKIIYSEKESDFYAELAKENEQNLVFVPAFSGLG
APWWDASARGIILGIEASTKREHIVKASLESIAFQTNDLLNAMASDIGYKITSIKADGGI
VKSNYLMQFQADIADVIVSIPKNKETTAVGVCFLAGLACGFWKDIHQLEKLTTLDKKFKS
TMDPNIRKTKINSWHKAVERALKWKEID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggatctaaaaaaacaatacatcattgccttagatgaaggtactagttcttgtcgatca
attgtttttgatcacaaccttaaccaaatagcaatagcacaaaacgaatttaacactttt
tttcctaatagtggttgagttgaacaagatccactagaaatttgatcagcccaactagct
accatgcaaagtgctaaaaataaagcacaaatcaaatctcatgaagtgattgcagttggt
attaccaatcaaagagaaacaatagttttatgaaataaagagaatggtttgcctgtttat
aatgccattgtttgacaggatcaaagaactgcagcactatgtcaaaaattcaatgaggat
aagttaatccaaaccaaagtaaaacaaaaaactggattacctattaacccctattttagt
gctactaagatagcttgaatcttaaaaaatgttcctttagcaaagaaactaatggagcaa
aaaaagttgttatttggcaccattgatagctgattaatctgaaaactaactaatggaaaa
atgcatgttacagatgtttcaaatgcttcaagaactcttttatttgacattgtcaaaatg
gagtgatccaaagagttatgtgatttatttgaagtaccagtttcaatcttacctaaagtt
ctgagttccaatgcttactttggtgatattgaaactaatcactgatctagtaatgctaaa
ggtattgtaccaattagagcagttttaggagaccagcaagcagctttgtttggtcagctc
tgtactgaacctggaatggtaaaaaatacctatggtactggatgttttgcactcatgaac
attggtgataaaccaacactctcaaagcacaatctgctcacaacagtagcatgacaacta
gaaaatcatccacctgtatatgcattggaaggtagtgtgtttgtagcgggtgcggctata
aaatggttaagggatgcattaaaaattatctattcagaaaaggaaagtgatttttatgca
gaacttgcaaaagaaaatgaacaaaacctagtttttgtaccagctttcagtggacttgga
gctccttgatgagatgctagtgctaggggtattatcttaggaattgaagcaagcactaaa
agagaacacatagtaaaagctagcttagagtcaattgcttttcaaactaatgatttatta
aatgcaatggcaagtgatataggttataagattactagcattaaagctgatggggggatt
gttaaatcaaactatttaatgcagtttcaagctgatattgcagatgtaattgtttctatc
cctaaaaataaagaaaccactgcagttggtgtttgttttttagctggacttgcttgtgga
ttttgaaaagacattcatcaacttgaaaaactcactactcttgataaaaagttcaaaagc
actatggacccaaacataagaaaaaccaaaattaacagttgacataaagcagttgaacgt
gctttaaaatggaaagaaattgattaa

DBGET integrated database retrieval system