KEGG   Mycoplasma genitalium M2288: CM5_01340Help
Entry
CM5_01340         CDS       T02208                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CM5_01340
   00670 One carbon pool by folate
    CM5_01340
Enzymes [BR:mgu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CM5_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274371..274853
Genome map
AA seq 160 aa AA seqDB search
MLIAIWAMTQEGLIGNNNTLPWMIKQELAHFKKTTLFQALLMGRKTYESLPKVFEKRTIF
LLSKDQNYRFEEKGSEVKVINDFWPLIKSYQANKEKDLFICGGKSVYEQTINECDQLIVS
IIKKKYKGDQFLKVDLSKFVLNEVVEFEEFNVNYYRKKQQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgctaattgctatctgagcgatgacacaagaaggactaataggtaataacaacacttta
ccttggatgattaaacaagagctagctcactttaaaaaaactacgttatttcaagctttg
ttaatggggagaaaaacttacgaatcactccccaaggtatttgaaaaaagaacaatattt
ctcctttcaaaagatcaaaactaccgttttgaagaaaagggaagtgaagtgaaagttatt
aatgatttttgaccactaattaaaagttaccaagcaaataaagaaaaggatttgtttatt
tgtggtggaaaaagtgtgtatgaacagaccattaatgaatgtgatcagttaattgtttca
atcattaaaaagaagtataagggtgatcagtttttgaaggttgatctcagtaaatttgta
cttaatgaagttgtagagtttgaggaatttaatgttaattattatagaaagaaacaacaa
taa

DBGET integrated database retrieval system