KEGG   Mycoplasma genitalium M2288: CM5_01600Help
Entry
CM5_01600         CDS       T02208                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
mgu00010  Glycolysis / Gluconeogenesis
mgu00020  Citrate cycle (TCA cycle)
mgu00620  Pyruvate metabolism
mgu01100  Metabolic pathways
mgu01110  Biosynthesis of secondary metabolites
mgu01120  Microbial metabolism in diverse environments
mgu01130  Biosynthesis of antibiotics
mgu01200  Carbon metabolism
Module
mgu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM5_01600
   00020 Citrate cycle (TCA cycle)
    CM5_01600
   00620 Pyruvate metabolism
    CM5_01600
Enzymes [BR:mgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CM5_01600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFQ04602
Position
complement(329536..330690)
Genome map
AA seq 384 aa AA seqDB search
MANEFKFTDVGEGLHEGKVTEILKQVGDQIKIDEALFVVETDKVTTELPSPFAGTISAIN
VKVGDVVSIGQVMAVIGEKTSTPIVEPKPQPTEEVTKVKEAGASVVGEIKVSDNLFPIFG
VKPHATPAVKDTKVASSTNITVETTQKPESKTEQKTIAISTMRKAIAEAMTKSHAIIPTT
VLTFYVNATKLKQYRESVNGYALSKYSMKISYFAFFVKAIVNALKKFPVFNASYDPDQNE
IVLNDDINVGIAVDTEEGLIVPNIKQAQTKSVVEIAQAIVDLANKARTKKIKLTDLNKGT
ISVTNFGSLGAAVGTPIIKYPEMCIVATGNLEERIVKVENGIAVHTILPLTIAADHRWVD
GADVGRFGKEIAKQIEELIDLTVA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagtttaaattcactgatgttggtgagggtttacatgaaggaaaagtaact
gaaatcttaaaacaagttggtgatcagatcaagatagatgaagctttatttgttgttgaa
actgataaagttacaaccgaattaccttctccttttgcaggtacaattagcgctattaat
gttaaagttggtgatgttgttagcattggtcaggtgatggcagttattggtgaaaagact
agtacaccaattgttgaaccaaaacctcaaccaactgaagaagtaactaaggtaaaagaa
gcgggggcttcagtagtaggggaaattaaggtttctgataacctctttcctatctttgga
gtaaaacctcatgcaactccagctgttaaagacactaaagttgcaagtagtactaacatt
actgtagaaacaacccaaaaaccagaaagtaaaactgaacagaaaaccattgctatctca
acaatgcgcaaagcgattgcagaagcaatgacaaagtcgcacgcaattatcccaaccact
gtattaactttttatgttaatgcaaccaagttaaaacaatatcgtgaaagtgttaatggt
tatgctttaagtaagtattccatgaaaatttcttactttgctttctttgttaaagcaatt
gttaatgcgcttaagaagttccctgtttttaacgctagttatgatcctgatcaaaacgaa
attgttttaaatgatgacattaatgtaggaattgctgttgatactgaagaaggtttaatt
gtccctaacattaagcaagcccaaaccaaatctgtggttgaaattgcccaagcaattgtt
gatttagctaacaaagctagaacaaaaaagattaagttgactgatttgaataaaggtact
atttcagttactaacttcggttcattaggagcagctgtaggtacacctattattaagtac
cctgagatgtgtattgttgctactggtaatttagaagaacgcattgttaaagtggaaaat
ggaattgcagttcataccatcttacctttaacaatagctgcagaccaccgctgggttgat
ggggcggatgttggtaggtttggtaaggagattgcaaaacaaattgaggaattaattgat
cttacagtagcttaa

DBGET integrated database retrieval system