KEGG   Mycoplasma genitalium M2288: CM5_02130Help
Entry
CM5_02130         CDS       T02208                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mgu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CM5_02130 (ruvA)
Enzymes [BR:mgu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CM5_02130 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456247..456864
Genome map
AA seq 205 aa AA seqDB search
MITSIFGKVTFVGKRKIIVEHNWISYWFNTKENHKFEKNLEKNKQIFCHIIKKIVANQII
EEAFAFNTLEEKEWFCRLIELNGIGSKTALNLLNNDLEEIKQYILENNYSALCGINGVNN
KIARALLSLEIFEKSENNKNIKGVQVADGYDELFETLKSLGYKQQEIQDALKMIEVKPDF
DISQLVAEVIKLMSFKNNEITNKTA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattacatctatctttggaaaagttacttttgtaggcaaaagaaaaataattgttgag
cacaactggatttcatattgatttaatacaaaagaaaaccataaatttgaaaaaaatttg
gaaaaaaataagcaaattttttgtcatattattaaaaaaattgtcgctaaccaaattata
gaagaggcttttgcctttaatactctagaagaaaaagagtggttctgtagattaatagaa
ctcaatggtattggtagtaaaactgcacttaatttgctcaataatgaccttgaggaaatt
aaacaatacattctggaaaataactacagtgcattatgtggtattaacggtgtaaataac
aaaatagctcgtgcacttttatcacttgaaatatttgaaaaatctgaaaataataaaaat
attaaaggagttcaagttgctgatggttatgatgaattgtttgaaacactaaagtcactt
ggttacaaacaacaagaaattcaggatgcactaaaaatgatagaagtaaaacctgatttt
gatataagtcagttagttgcagaagtaattaaattaatgtcttttaagaataatgaaatt
acaaataaaaccgcctaa

DBGET integrated database retrieval system