KEGG   Mycoplasma genitalium M2288: CM5_02500Help
Entry
CM5_02500         CDS       T02208                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CM5_02500
   01230 Biosynthesis of amino acids
    CM5_02500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM5_02500
   00051 Fructose and mannose metabolism
    CM5_02500
   00562 Inositol phosphate metabolism
    CM5_02500
Enzymes [BR:mgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CM5_02500
Exosome [BR:mgu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CM5_02500
  Exosomal proteins of bladder cancer cells
   CM5_02500
  Exosomal proteins of melanoma cells
   CM5_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(537043..537777)
Genome map
AA seq 244 aa AA seqDB search
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIAPVYVHLTEIKKIISDSLLLF
AQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQ
VVLCIGETLGQEISFLKTDLTNCLNTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTI
KTIREYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMA
RVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaggtatttaattggcaattggaaaacaaataaaaatttaaaagacgcagtt
agttttgttgaacaatttcaacaaaataaacttaattacaatgccaaaattgggatagca
cctgtttatgttcatctcactgaaataaaaaaaataattagtgatagtctccttttattt
gcccaagacgctaactttattgaaagtggttcatatactggaactgtaagctttactcaa
cttcaagacattggtgttaacaacagtattattggtcattctgaaagaagaaaatactat
aacgaaaccagtgcagttattaatcaaaagctctttgcttgtctaaaagcatccatgcaa
gtagttttatgtattggtgagactttaggacaagagattagctttcttaaaactgatctt
actaattgcttaaatacgattgacaaaagcttaattaaaaatttagttattgcttatgaa
cctttgtgagcaattgggacaggtaaaacagcaactcctgaagttgcaaatcaaaccatt
aaaaccattagggaatatattaatgacttatatgatgaaaatgttgctaacaatatctca
attctatatggcggatcagttgatcataataatatccaaaaactagcaataatggaacaa
attgatggatttttagttggtaaagcatctttagaaattaaaaactttttagaaatggct
agggtatatgcataa

DBGET integrated database retrieval system