KEGG   Mycoplasma genitalium M2288: CM5_02500Help
Entry
CM5_02500         CDS       T02208                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgu  Mycoplasma genitalium M2288
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CM5_02500
   01230 Biosynthesis of amino acids
    CM5_02500
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM5_02500
   00051 Fructose and mannose metabolism
    CM5_02500
   00562 Inositol phosphate metabolism
    CM5_02500
Enzymes [BR:mgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CM5_02500
Exosome [BR:mgu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CM5_02500
  Exosomal proteins of bladder cancer cells
   CM5_02500
  Exosomal proteins of melanoma cells
   CM5_02500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(537043..537777)
Genome map
AA seq 244 aa AA seqDB search
MRTRYLIGNWKTNKNLKDAVSFVEQFQQNKLNYNAKIGIAPVYVHLTEIKKIISDSLLLF
AQDANFIESGSYTGTVSFTQLQDIGVNNSIIGHSERRKYYNETSAVINQKLFACLKASMQ
VVLCIGETLGQEISFLKTDLTNCLNTIDKSLIKNLVIAYEPLWAIGTGKTATPEVANQTI
KTIREYINDLYDENVANNISILYGGSVDHNNIQKLAIMEQIDGFLVGKASLEIKNFLEMA
RVYA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaaggtatttaattggcaattggaaaacaaataaaaatttaaaagacgcagtt
agttttgttgaacaatttcaacaaaataaacttaattacaatgccaaaattgggatagca
cctgtttatgttcatctcactgaaataaaaaaaataattagtgatagtctccttttattt
gcccaagacgctaactttattgaaagtggttcatatactggaactgtaagctttactcaa
cttcaagacattggtgttaacaacagtattattggtcattctgaaagaagaaaatactat
aacgaaaccagtgcagttattaatcaaaagctctttgcttgtctaaaagcatccatgcaa
gtagttttatgtattggtgagactttaggacaagagattagctttcttaaaactgatctt
actaattgcttaaatacgattgacaaaagcttaattaaaaatttagttattgcttatgaa
cctttgtgagcaattgggacaggtaaaacagcaactcctgaagttgcaaatcaaaccatt
aaaaccattagggaatatattaatgacttatatgatgaaaatgttgctaacaatatctca
attctatatggcggatcagttgatcataataatatccaaaaactagcaataatggaacaa
attgatggatttttagttggtaaagcatctttagaaattaaaaactttttagaaatggct
agggtatatgcataa

DBGET integrated database retrieval system