KEGG   Mycoplasma gallisepticum VA94_7994-1-7P: HFMG94VAA_1946Help
Entry
HFMG94VAA_1946    CDS       T02203                                 

Gene name
tuf
Definition
translation longation factor Tu (EF-Tu)
Orthology
K02358  
elongation factor Tu
Organism
mgv  Mycoplasma gallisepticum VA94_7994-1-7P
Brite
Mitochondrial biogenesis [BR:mgv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HFMG94VAA_1946 (tuf)
Exosome [BR:mgv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HFMG94VAA_1946 (tuf)
  Exosomal proteins of breast cancer cells
   HFMG94VAA_1946 (tuf)
  Exosomal proteins of colorectal cancer cells
   HFMG94VAA_1946 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325794..326978
Genome map
AA seq 394 aa AA seqDB search
MAKERFDRSKPHVNIGTIGHIDHGKTTLTAAICTVLSKAGTSEAKKYDEIDAAPEEKARG
ITINTAHVEYATQNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSATDGPMPQTREHI
LLARQVGVPKMVVFLNKCDVADDPEMQELVEMEVRDLLKSYGFDGDNTPVIRGSALGALN
GEPVWEEKIHELMKAVDEYIPTPDREVDKPFLLPIEDTMTITGRGTVVTGRVERGQLKVG
EEVEIVGITDTRKVVVTGIEMFRKELDAAMAGDNAGILLRGVDRKDVQRGQVLAKPGSIT
PHKKFRAEIYALKKDEGGRHTAFLNGYRPQFYFRTTDVTGSIQLKEGTEMVMPGDNTEII
VELISSIACEKGSKFSIREGGRTVGAGTVVEVLE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaggttcgatcgtagtaaacctcacgttaatattggaacaatcggtcat
attgaccacgggaaaactacattaaccgcagcaatttgtaccgtgttatcaaaagctggt
acatctgaagctaaaaaatatgatgaaattgatgctgcaccagaagaaaaagctcgtggg
attacaattaacactgcacacgtagaatacgcaactcaaaatcgtcactatgcacacgtt
gactgtcctggtcacgccgactacgttaaaaacatgattacaggtgctgctcaaatggac
ggtggtatcttagttgtttctgcaactgatggtccaatgcctcaaactcgtgaacacatc
ctattagctcgccaagttggtgttcctaagatggttgtattcttaaacaaatgtgatgta
gctgatgatccagaaatgcaagaattagttgaaatggaagttagagatcttcttaaatct
tacggatttgatggtgataacactccagtaatcagaggttctgctttaggtgctcttaat
ggtgaacctgtatgagaagaaaaaattcatgaactaatgaaagcagttgatgaatacatc
ccaactcctgaccgtgaagttgataaaccattcttattaccaatcgaagatactatgaca
attactggtcgtggtactgtagtaactggtagagttgaacgtggtcaacttaaagttggt
gaagaagttgaaatcgttggtattactgacactagaaaagtagtagtaactggtattgaa
atgttcagaaaagaactagatgctgctatggctggtgacaacgctgggatcttacttcgt
ggtgtagaccgtaaagatgtacaacgcggtcaagttttagctaaacctggttcaattact
ccacacaagaaattcagagctgaaatttatgcgcttaagaaggatgaaggtggtcgtcac
acagctttcttaaatggttacagacctcaattctacttcagaacaactgacgtaactggt
tcaatccaattaaaagaaggaactgaaatggttatgcctggtgataacacagaaattatc
gttgaattaatttcttcaatcgcttgtgaaaaaggttctaagttctctatccgtgaaggt
ggtagaactgtaggtgctggtacagttgtagaagtacttgaatag

DBGET integrated database retrieval system