KEGG   Mycoplasma gallisepticum VA94_7994-1-7P: HFMG94VAA_1946Help
Entry
HFMG94VAA_1946    CDS       T02203                                 

Gene name
tuf
Definition
translation longation factor Tu (EF-Tu)
Orthology
K02358  
elongation factor Tu
Organism
mgv  Mycoplasma gallisepticum VA94_7994-1-7P
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325794..326978
Genome map
AA seq 394 aa AA seqDB search
MAKERFDRSKPHVNIGTIGHIDHGKTTLTAAICTVLSKAGTSEAKKYDEIDAAPEEKARG
ITINTAHVEYATQNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSATDGPMPQTREHI
LLARQVGVPKMVVFLNKCDVADDPEMQELVEMEVRDLLKSYGFDGDNTPVIRGSALGALN
GEPVWEEKIHELMKAVDEYIPTPDREVDKPFLLPIEDTMTITGRGTVVTGRVERGQLKVG
EEVEIVGITDTRKVVVTGIEMFRKELDAAMAGDNAGILLRGVDRKDVQRGQVLAKPGSIT
PHKKFRAEIYALKKDEGGRHTAFLNGYRPQFYFRTTDVTGSIQLKEGTEMVMPGDNTEII
VELISSIACEKGSKFSIREGGRTVGAGTVVEVLE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaggttcgatcgtagtaaacctcacgttaatattggaacaatcggtcat
attgaccacgggaaaactacattaaccgcagcaatttgtaccgtgttatcaaaagctggt
acatctgaagctaaaaaatatgatgaaattgatgctgcaccagaagaaaaagctcgtggg
attacaattaacactgcacacgtagaatacgcaactcaaaatcgtcactatgcacacgtt
gactgtcctggtcacgccgactacgttaaaaacatgattacaggtgctgctcaaatggac
ggtggtatcttagttgtttctgcaactgatggtccaatgcctcaaactcgtgaacacatc
ctattagctcgccaagttggtgttcctaagatggttgtattcttaaacaaatgtgatgta
gctgatgatccagaaatgcaagaattagttgaaatggaagttagagatcttcttaaatct
tacggatttgatggtgataacactccagtaatcagaggttctgctttaggtgctcttaat
ggtgaacctgtatgagaagaaaaaattcatgaactaatgaaagcagttgatgaatacatc
ccaactcctgaccgtgaagttgataaaccattcttattaccaatcgaagatactatgaca
attactggtcgtggtactgtagtaactggtagagttgaacgtggtcaacttaaagttggt
gaagaagttgaaatcgttggtattactgacactagaaaagtagtagtaactggtattgaa
atgttcagaaaagaactagatgctgctatggctggtgacaacgctgggatcttacttcgt
ggtgtagaccgtaaagatgtacaacgcggtcaagttttagctaaacctggttcaattact
ccacacaagaaattcagagctgaaatttatgcgcttaagaaggatgaaggtggtcgtcac
acagctttcttaaatggttacagacctcaattctacttcagaacaactgacgtaactggt
tcaatccaattaaaagaaggaactgaaatggttatgcctggtgataacacagaaattatc
gttgaattaatttcttcaatcgcttgtgaaaaaggttctaagttctctatccgtgaaggt
ggtagaactgtaggtgctggtacagttgtagaagtacttgaatag

DBGET integrated database retrieval system