KEGG   Mycoplasma gallisepticum VA94_7994-1-7P: HFMG94VAA_2056Help
Entry
HFMG94VAA_2056    CDS       T02203                                 

Gene name
mutM
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mgv  Mycoplasma gallisepticum VA94_7994-1-7P
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mgv03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341858..342682
Genome map
AA seq 274 aa AA seqDB search
MPELPEVQTVINYLKTKIINQKINNVIVSALKVLKNATAKEFKKFLVNEHFVDIKRIGKY
IIFILSNNKVLVSHLRMEGKYKISQFKAKYDERHVLVRFILDDFELHYHDTRRFGTFHIH
SVLDYQDQDYLKKLAIDPTQQEWDWKYLKNNAQKSSRVIKSVLLDQSVVAGIGNIYADEI
LFLSKINPAKKANELTDQQFKEISKNATKVLLKAIELNGTTIFSYQFKENHAGSYQDYLN
VHLQKDKPCKVCGNLVKKTKLNNRGTYYCAKCQK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactaccagaagtccaaacggtgattaattatcttaaaactaagattattaat
caaaagatcaacaatgtcattgttagtgcactaaaagtgttaaaaaacgcgacagcaaaa
gaatttaagaaattccttgtcaatgaacactttgttgacattaaaagaattggtaagtat
atcatctttattttgtctaacaacaaagtgttggtttcccacctaagaatggagggaaaa
tataagattagtcagtttaaagctaagtatgatgaacgtcatgtgttagtacgatttatc
ttagatgattttgaactgcactatcatgacacaagaagatttgggacgtttcatattcat
agtgttcttgattaccaagatcaagattatttaaagaaattagcaattgatcccacacaa
caagaatgagattggaaatacctaaaaaataatgctcaaaaatcttcaagggtaattaaa
tcagttttattagatcaatctgtagttgctgggattggtaatatttatgctgatgagatc
ttattcttatctaagattaatccagctaaaaaagccaacgaactaactgatcaacagttt
aaagaaattagtaagaatgcaactaaagttttattaaaagcgatcgaactaaacgggaca
acgatcttttcttatcagtttaaagaaaaccatgctggttcataccaggattatttaaat
gtccatttacaaaaagataaaccatgtaaggtttgtggtaacttagttaaaaaaactaaa
ttaaataaccggggaacttattattgtgcgaaatgtcaaaaatag

DBGET integrated database retrieval system