KEGG   Mycoplasma gallisepticum VA94_7994-1-7P: HFMG94VAA_3682Help
Entry
HFMG94VAA_3682    CDS       T02203                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase (E2) component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgv  Mycoplasma gallisepticum VA94_7994-1-7P
Pathway
mgv00010  Glycolysis / Gluconeogenesis
mgv00020  Citrate cycle (TCA cycle)
mgv00620  Pyruvate metabolism
mgv01100  Metabolic pathways
mgv01110  Biosynthesis of secondary metabolites
mgv01120  Microbial metabolism in diverse environments
mgv01130  Biosynthesis of antibiotics
mgv01200  Carbon metabolism
Module
mgv_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG94VAA_3682 (aceF)
   00020 Citrate cycle (TCA cycle)
    HFMG94VAA_3682 (aceF)
   00620 Pyruvate metabolism
    HFMG94VAA_3682 (aceF)
Enzymes [BR:mgv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HFMG94VAA_3682 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 DUF2118 DUF1999 E3_binding
Motif
Other DBs
NCBI-ProteinID: AFP76048
Position
complement(625136..626464)
Genome map
AA seq 442 aa AA seqDB search
MFEYKFTDVGEGLHEGVVAQIYVKVGDTIKEGDPMFSVETDKVTTDLPAPEGGKVTAILA
SVGQTVHVGEVMLVLNGDGSSAPAAAPAPAAAPATPAFVAPTPAVTPAPAPTEAAPSGGG
ASVVGEVKVSNTLFGLFGDQRAASTLTPAPATAFAPTPAPVATPLAQAVASDLNVNLHNV
TPANGAKVFSSDVFASAQQSSLAASVAANDNETYKEITSIRKAIAKAMTTAHEEIPATVL
TFNFDVTKLVSYRKQVKDAVLASYNVKLSFLPFLLKAITKAVVAHPVFNSHYDKASNRLV
LKKKINLGIAVDTADGLMVPNIKSAQDKSVIELAREVNNLAEKARSKKIGLADLADGTIS
VTNFGSIGALFGTPIIKFPEVAIIATGTIEEKLARTPENQIVIKQIMPITIAADHRWIDG
ADIGRFAKTLKEIVENLDGLLI
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatataaatttacagacgttggtgaagggctacacgaaggtgttgttgctcaa
atctatgttaaagtaggtgacacaattaaagaaggcgacccaatgttttcagtcgaaact
gataaggttacaactgacttaccagctcctgaaggtggaaaagttactgcgatccttgca
tcagtaggacaaactgttcacgttggtgaagtaatgcttgttttaaacggtgatggttca
tcagctccagctgctgcgccagctccagctgctgcgcctgctactccagcttttgtagct
cctactccagctgttacaccagctcctgctcctactgaagctgctcctagtggtggtggt
gcttcagttgtaggtgaagttaaagtttcaaacactttatttggattatttggtgatcaa
cgcgctgcaagcactctaacaccagctcctgctacagcttttgcgccaactccagctcca
gttgcgactcctttagctcaagctgttgctagtgatttaaatgtaaatttacacaacgta
acacctgctaacggtgctaaagtattctcaagcgatgtatttgcatcagctcaacaaagt
tcactagctgctagtgtagctgcaaacgataacgaaacttacaaagaaattacatcaatt
agaaaagcaattgctaaagcaatgactactgctcacgaagaaattccagcaactgtttta
acattcaactttgatgtaactaaattagtatcataccgtaagcaagttaaggatgctgta
ttagcaagttacaatgttaaattatcattcttaccattcttattaaaagcaattactaaa
gctgtagttgctcacccagttttcaactctcactacgacaaagctagcaaccgcttagta
ttaaagaaaaagattaacttaggtattgctgttgatactgctgatggtttaatggttcct
aacattaaatcagctcaagacaaatcagtgattgaacttgctagagaagtaaacaattta
gctgaaaaagctcgctctaagaagatcggtttagctgatttagctgatggtacaatcagt
gtaactaactttggttcaatcggggctttatttggtacaccaattattaaattcccagaa
gttgcaattattgctactggtacaatagaagaaaaattagcaagaactcctgaaaaccaa
atcgtaattaagcaaattatgccaattacaattgcagctgaccacagatgaatcgatggt
gctgatatcggtagatttgctaaaacattaaaagaaatcgttgaaaatcttgacggttta
ctaatttaa

DBGET integrated database retrieval system