KEGG   Mycoplasma gallisepticum VA94_7994-1-7P: HFMG94VAA_4511Help
Entry
HFMG94VAA_4511    CDS       T02203                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgv  Mycoplasma gallisepticum VA94_7994-1-7P
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HFMG94VAA_4511 (tpiA)
   01230 Biosynthesis of amino acids
    HFMG94VAA_4511 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG94VAA_4511 (tpiA)
   00051 Fructose and mannose metabolism
    HFMG94VAA_4511 (tpiA)
   00562 Inositol phosphate metabolism
    HFMG94VAA_4511 (tpiA)
Enzymes [BR:mgv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HFMG94VAA_4511 (tpiA)
Exosome [BR:mgv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HFMG94VAA_4511 (tpiA)
  Exosomal proteins of bladder cancer cells
   HFMG94VAA_4511 (tpiA)
  Exosomal proteins of melanoma cells
   HFMG94VAA_4511 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(764330..765088)
Genome map
AA seq 252 aa AA seqDB search
MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVAPVFVHLGLANQLKRNE
CLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRKLFHESDELINQKVKTLLE
NKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSLLKDLIIAYEPVWAIGTGKTA
SSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTPDNVSELLAQKDINGALVGGASL
DPHKFIQLIEAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatgaaaagatacatctttggaaattgaaaaacatataaaactactcaagaa
gttaaagagttttttagtgttttaaatcaaactaagttaaccaaaaacccagacgtggtt
tttggtgttgcaccagtattcgtacatttgggtttggctaatcaattaaaaagaaacgaa
tgtttagttttagctcaagatgctaattatgtaatgaataaagctaacacgggaaccgtt
agttatgaacaattaaaagatattggtgttaattacgtaataattggtcactctgaacga
agaaaattatttcatgaatctgatgaactaattaatcagaaagtaaaaacgctattagaa
aataagatgagaccaattttatgtattggtgaaacgttagaagaatacgaagctaacaag
accaaagctgtacttaaagatcagttagaaaaagatcttaaaggaattgatagttcttta
ttaaaagatctaattattgcttatgaaccagtttgggcgatcggaacaggtaagactgct
tcaagtcaaactgcgcaagatgcaatcgcttatattcgaactgttctaggtttattatca
tcaaaaacgatcgcaaatgagttaccaattttatatggtggatcagttactcctgataat
gtttcagaactgttagcacaaaaagacattaatggagcactagtgggtggagcttcatta
gacccacacaaatttatccaacttattgaagctaaataa

DBGET integrated database retrieval system