KEGG   Mycoplasma gallisepticum WI01_2001.043-13-2P: HFMG01WIA_0088Help
Entry
HFMG01WIA_0088    CDS       T02204                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mgw  Mycoplasma gallisepticum WI01_2001.043-13-2P
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgw00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HFMG01WIA_0088 (glpK)
Enzymes [BR:mgw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HFMG01WIA_0088 (glpK)
Exosome [BR:mgw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HFMG01WIA_0088 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(15180..16121)
Genome map
AA seq 313 aa AA seqDB search
MDWDQELLDLFEIPRSILPEVKSSSEVYGYVEPSLWSQRATAKVPITGVAGDQQSALFGQ
LCLKPGMVKNTYGTGCFTLMNIGEEPIMSKNKLLTTVAWKLGKKKPVYALEGSVFIAGAA
VQWIRDGLRLIYDAAESDFYANLASKQDTHQIYLVPSFTGLGAPYWDSYSRGAIFGLERG
TKKEHIIKATLESIVFQTNDLIKAMSSDVDKKIEVVKVDGGATRSEYIMQFQSSISGVNV
IRPKNIESTALGATFLAGLAVGYWKDLKELEKLVKVDKEFKPKLDKEKVEKLVHGWNVAV
KRTFNWMKEVDLK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggattgggatcaagaattattagatttatttgaaatccctcggtcgattcttccagaa
gttaaatcttcttctgaagtatatggttatgtagaacctagcttatgatctcaacgagct
actgctaaggttccaattacaggtgttgctggtgaccaacaatctgctttatttggtcag
ttgtgtcttaaacctggaatggttaaaaacacctatggaacaggttgcttcaccttaatg
aacattggcgaagaaccaattatgtctaagaacaaactgttaacaacggttgcttggaaa
ctaggtaagaaaaaaccagtttatgcccttgaaggttctgtgtttattgctggagctgct
gtccaatgaatacgtgacggactaagattaatttatgatgcagctgaatctgatttttat
gctaatttagcttctaaacaagacactcaccaaatttatttagttccttcatttactgga
ttaggtgctccttattgggactcttattcacgtggagcaatctttggtcttgaacgtgga
actaaaaaagaacatattattaaagcaacacttgaatcgattgtgttccaaactaatgat
ctgattaaagctatgtcttctgatgttgataaaaagatcgaagttgttaaagttgatggt
ggtgcaactagatctgaatacatcatgcaattccaatcatcaatctcaggggttaatgta
attagacctaagaatattgaatcaaccgcattaggggcaaccttcttagctggtttagct
gttggttattgaaaagatctaaaagagcttgaaaaactagttaaagtcgataaagagttc
aaacctaaactagataaagaaaaagttgaaaaattagttcatggttgaaatgttgcggta
aaaagaacatttaattgaatgaaagaggtggatcttaaataa

DBGET integrated database retrieval system