KEGG   Mycoplasma gallisepticum WI01_2001.043-13-2P: HFMG01WIA_0663Help
Entry
HFMG01WIA_0663    CDS       T02204                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mgw  Mycoplasma gallisepticum WI01_2001.043-13-2P
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mgw00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
108590..109696
Genome map
AA seq 368 aa AA seqDB search
MKILVLGATGSIGKQTIDVICQLKYQLVGFSYYQNHNEANNILKQLNPNYVLCHSDPKYN
KNVKSDLIELIDKSKPKVIINAINGYHGIEASLIALSKKKDLLLANKESLVIAGSQLEAI
RKDTKTTIYPIDSEHSALYDLLKDKKKNQIKQLMITASGAGYFNKDISELRKLTYNDLLN
HPNWKMGAEISINSATFVNKVYEIVEAYHLFKIKDIIPVVERSSTIHAGVIYQDNSIHFH
ATTNDMRWAIQSALTKFDNRTNVVQSLDLYQKTIQFEKIDFEQYPIFKIAYDILKNPYTT
RGAVLTCINQHVVKLFQKQKINFLQITELISNFYWNYQHKKIDDIWQINDLIFKIKAAIS
SKYAYLDK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttagtgcttggagcaactggatcaattggcaagcaaacaattgatgtgatc
tgccaactaaagtaccaattagttggtttttcttattatcaaaaccacaatgaagccaat
aatattcttaaacaattaaatcccaactatgttttatgtcatagtgatcccaaatacaat
aagaatgttaagagtgatttaattgagctaattgataaaagtaagcctaaagttattatt
aatgcaattaatggttatcatggaattgaagcttcattaattgcgcttagtaagaaaaaa
gatctcttgttagctaataaagaatcgttagtgattgctggatcacaactagaagcaatt
agaaaagatacgaaaacaacgatctatccgatcgattcagagcacagtgcactgtatgat
ttattaaaagataagaaaaaaaatcagattaaacaattaatgatcacagcatctggagcg
ggatattttaataaagatataagtgagcttagaaagctcacttataatgatctcttaaat
catcctaattggaagatgggtgcagagatctcgattaattcagctacgttcgtaaacaaa
gtttatgagattgttgaagcttatcatctttttaaaataaaagatattatccccgtggtg
gaaagaagttcgacaatccatgctggggtgatctatcaagataattcgattcattttcat
gcgacgaccaacgacatgcgttgagcgatccagtcagcactaaccaaatttgataataga
actaacgttgttcaatcgttagatctttatcaaaaaacgattcaatttgaaaaaattgat
tttgaacaatatccgatatttaaaattgcttatgatatattaaaaaatccctacacgaca
agaggagctgtactgacttgtattaatcaacatgtcgttaagttgtttcaaaagcaaaag
atcaattttttacagattactgaactgattagtaatttttattgaaactatcaacataaa
aaaattgatgacatttggcaaataaacgatttaatatttaaaattaaagcagcgatctca
agcaaatatgcttatttagataaataa

DBGET integrated database retrieval system