KEGG   Mycoplasma gallisepticum WI01_2001.043-13-2P: HFMG01WIA_4362Help
Entry
HFMG01WIA_4362    CDS       T02204                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mgw  Mycoplasma gallisepticum WI01_2001.043-13-2P
Pathway
mgw00010  Glycolysis / Gluconeogenesis
mgw00051  Fructose and mannose metabolism
mgw01100  Metabolic pathways
mgw01110  Biosynthesis of secondary metabolites
mgw01120  Microbial metabolism in diverse environments
mgw01130  Biosynthesis of antibiotics
mgw01200  Carbon metabolism
mgw01230  Biosynthesis of amino acids
Module
mgw_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mgw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HFMG01WIA_4362 (tpiA)
   00051 Fructose and mannose metabolism
    HFMG01WIA_4362 (tpiA)
   00562 Inositol phosphate metabolism
    HFMG01WIA_4362 (tpiA)
Enzymes [BR:mgw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HFMG01WIA_4362 (tpiA)
Exosome [BR:mgw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HFMG01WIA_4362 (tpiA)
  Exosomal proteins of bladder cancer cells
   HFMG01WIA_4362 (tpiA)
  Exosomal proteins of melanoma cells
   HFMG01WIA_4362 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CO_dh
Motif
Other DBs
NCBI-ProteinID: AFP79203
UniProt: J3VHF3
Position
complement(740220..740978)
Genome map
AA seq 252 aa AA seqDB search
MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVAPVFVHLGLANQLKRNE
CLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRKLFHESDELINQKVKTLLE
NKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSLLKDLIIAYEPVWAIGTGKTA
SSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTPDNVSELLAQKDINGALVGGASL
DPHKFIQLIEAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtatgaaaagatacatctttggaaattgaaaaacatataaaactactcaagaa
gttaaagagttttttagtgttttaaatcaaactaagttaaccaaaaacccagacgtggtt
tttggtgttgcaccagtattcgtacatttgggtttggctaatcaattaaaaagaaacgaa
tgtttagttttagctcaagatgctaattatgtaatgaataaagctaacacgggaaccgtt
agttatgaacaattaaaagatattggtgttaattacgtaataattggtcactctgaacga
agaaaattatttcatgaatctgatgaactaattaatcagaaagtaaaaacgctattagaa
aataagatgagaccaattttatgtattggtgaaacgttagaagaatacgaagctaacaag
accaaagctgtacttaaagatcagttagaaaaagatcttaaaggaattgatagttcttta
ttaaaagatctaattattgcttatgaaccagtttgggcgatcggaacaggtaagactgct
tcaagtcaaactgcgcaagatgcaatcgcttatattcgaactgttctaggtttattatca
tcaaaaacgatcgcaaatgagttaccaattttatatggtggatcagttactcctgataat
gtttcagaactgttagcacaaaaagacattaatggagcactagtgggtggagcttcatta
gacccacacaaatttatccaacttattgaagctaaataa

DBGET integrated database retrieval system