KEGG   Mycoplasma gallisepticum WI01_2001.043-13-2P: HFMG01WIA_4589Help
Entry
HFMG01WIA_4589    CDS       T02204                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mgw  Mycoplasma gallisepticum WI01_2001.043-13-2P
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mgw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(780964..781584)
Genome map
AA seq 206 aa AA seqDB search
MTSDLDLNEFNNLVEQISDLPSVSKKQAKKITQYLMTKSDRYVYDLIDVLKRAKLSIKIC
EMCQGWSNRSICSICSDESRNKNELCIVSFFDDLNVIEESQAYHGKYFILNHEISKKNKR
IIEEINFDLLLDLIKKQKIEKVIIATNFTQDGQTTANYLRFLLDDFDLKIYRLGMGLPYN
SSIDYADSFSLKGAFENKQLIKDKKA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagatctagatctgaatgagtttaataatctagtagaacagattagcgactta
ccaagtgttagtaaaaaacaagccaaaaagattacccaatacttaatgactaaatcagat
cgttatgtttatgatctgattgatgttttaaaacgagctaaattatctatcaagatctgc
gagatgtgtcagggttgatcaaatcgttctatctgtagcatctgttcggatgaatcaaga
aataagaatgaactgtgtattgttagtttttttgatgatttaaatgtgattgaagaatcc
caagcttatcatggtaagtattttattcttaaccatgagatctctaaaaagaataaaaga
atcattgaagagattaattttgatctattattagatctgattaaaaaacaaaaaattgag
aaggtaattattgcgactaattttactcaagatgggcaaacaacagcaaattacttacgc
tttttattagatgattttgatcttaaaatctatcgtttaggtatgggtttaccatacaat
tcttcaattgattatgctgattcctttagtttaaaaggtgctttcgaaaacaaacagcta
ataaaagataaaaaagcgtaa

DBGET integrated database retrieval system