KEGG   Mycoplasma gallisepticum WI01_2001.043-13-2P: HFMG01WIA_4828Help
Entry
HFMG01WIA_4828    CDS       T02204                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mgw  Mycoplasma gallisepticum WI01_2001.043-13-2P
Pathway
mgw00230  Purine metabolism
mgw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HFMG01WIA_4828 (gmk)
Enzymes [BR:mgw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HFMG01WIA_4828 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 Rad17 RsgA_GTPase AAA_29 AAA_22 ABC_tran SRPRB NTPase_1 SpoU_sub_bind Roc AAA AAA_17 NB-ARC AAA_28 DUF3179 ATP-synt_ab MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: AFP79255
UniProt: J3YHH5
Position
complement(820343..820930)
Genome map
AA seq 195 aa AA seqDB search
MVVIYIMSNKQGLIILISGPSGVGKGTIVSRLLSDNNLKLNVSISATTRKKRASEVEGVH
YFFKTKEEFEQMIANNQLLEYANYVNNYYGTPLSLVKEILDKNENLILEIEYQGVIQVLR
KGFRTLSIFVLPPSEDELVARLKKRGTENDEVIKHRLEQAVKEYAHRELYDHTIINDDLE
KTIEDIKQLIRKYSQ
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggtagttatatatattatgagtaacaagcagggtttaattatcttaatatctggtcct
agtggggttggtaagggcacgatagttagtaggcttttgtctgacaacaacttaaaacta
aacgtttcaatttcagccacaacaagaaaaaagcgagcatctgaagttgaaggtgtgcat
tattttttcaaaactaaagaagagtttgaacaaatgattgccaacaaccaattattagag
tatgctaactacgttaataactattatggaacaccgctttcattagttaaagagatcctt
gataaaaacgaaaacctaattttagagattgaataccaaggggtgattcaagtcttaaga
aaaggttttagaacactaagtatctttgtgcttcccccttctgaagatgagttagttgca
cgactaaaaaaacggggaactgaaaacgacgaagtaattaaacaccgcttagaacaagct
gttaaagaatatgcccatagagaactttatgatcatacgatcattaatgatgatctagaa
aaaacgatcgaagatattaaacaactaattcgtaagtatagtcaataa

DBGET integrated database retrieval system