KEGG   Mycoplasma genitalium M6320: CM1_00620Help
Entry
CM1_00620         CDS       T02211                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CM1_00620
Enzymes [BR:mgx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CM1_00620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
134778..135347
Genome map
AA seq 189 aa AA seqDB search
MNNQGRIFVITGPSGVGKSTLVKALLDHFKEQLFYSISATTRKKRISEKEGIDYFFKDKD
EFENLIKQDAFIEWACYNNHYYGTLKSQAEQAIKSGINLMLEIEYQGALQVKSKYPHNVV
LIFIKPPSMQELLKRLKKRNDEDETTIKKRLEQAKIEFQQIDNFKYVVTNKEFDKTLNEL
KSILLSEFI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatcaggggagaatttttgtcattactggtcctagcggtgttggcaaaagcacc
cttgttaaagccttattagatcatttcaaagaacaactgttctacagtatctctgcaact
acaagaaaaaagcgcattagtgaaaaagagggaattgattatttttttaaagataaagat
gagtttgaaaacttaataaaacaagatgctttcattgaatgggcttgctataataaccat
tattatggaacgctcaagtctcaagctgaacaagcaattaaaagcggaattaatttaatg
cttgaaattgagtatcaaggtgctttacaggttaaaagtaaatatcctcataacgttgtt
ttaattttcattaaaccaccttcaatgcaagagttgttaaaacgtttaaaaaagcgtaat
gatgaagatgaaaccacaattaaaaaacgtttagaacaagctaagatagagtttcaacag
attgataattttaagtatgttgtcactaacaaagagtttgataaaacccttaatgagttg
aaatcaatcttactatctgagtttatttaa

DBGET integrated database retrieval system