KEGG   Mycoplasma genitalium M6320: CM1_01280Help
Entry
CM1_01280         CDS       T02211                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mgx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CM1_01280
   01230 Biosynthesis of amino acids
    CM1_01280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM1_01280
   00030 Pentose phosphate pathway
    CM1_01280
   00051 Fructose and mannose metabolism
    CM1_01280
   00052 Galactose metabolism
    CM1_01280
  Energy metabolism
   00680 Methane metabolism
    CM1_01280
Enzymes [BR:mgx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CM1_01280
Protein phosphatases and associated proteins [BR:mgx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CM1_01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254430..255401
Genome map
AA seq 323 aa AA seqDB search
MDKIAILTSGGDASGMNATIAYLTKYAIAKQLEVFYVKNGYYGLYHNHFITSKELDLTDF
FFMGGTVIGSSRFKQFQDPSLRKQAVLNLKKRGINNLVVIGGDGSYMGAKALSELGLNCF
CLPGTIDNDVNSSEFTIGFWTALEAIRVNVEAIYHTTKSHNRLAIIEVMGRDCSDLTIFG
GLATNASFVVTSKNSLDLNGFEKAVRKVLQFQNYCVVLVSENIYGKNGLPSLEMVKEHFE
NNAIKCNLVSLGHTQRGFSPNSIELFQISLMAKHTIDLVVNNANSQVIGMKNNQAVNYDF
NTAFNLPKADRTKLLNQVNTAII
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatagctattttaacttcgggtggtgatgctagtgggatgaatgccaccatc
gcttatctaaccaaatatgcaattgcaaagcaattggaagttttttatgtaaaaaacggt
tattatggcttgtatcacaaccattttatcaccagtaaggaacttgatttaactgacttt
ttctttatggggggaacagtaataggatcaagtcgtttcaaacagtttcaagatcctagc
ttacgaaaacaagcagttttaaacctcaaaaaacgtggtattaacaaccttgttgttatt
ggtggggatgggagttatatgggtgctaaagcactcagtgaattaggattaaactgcttt
tgtttacctggtacgatcgacaatgatgtcaattccagtgaatttaccattggtttttga
actgctttagaagcaattcgggttaatgttgaagcaatttatcacaccaccaaatcccat
aaccgcttagcaatcatagaagtgatggggcgtgattgtagtgatctgaccatctttggg
gggttagctactaatgctagttttgttgttactagcaaaaatagcttggatctcaatggc
tttgaaaaagcagtgagaaaggtgttgcaattccagaactattgtgttgttttggttagt
gaaaacatctatggtaagaacggtttacctagtttagaaatggttaaagagcactttgaa
aacaacgcaattaagtgtaacctagtttcactaggacacacccaaaggggctttagtcct
aatagtatcgaactctttcagattagtttaatggctaaacacacgattgatctggttgta
aataatgccaacagtcaagtaatagggatgaaaaacaaccaagcagttaactatgatttt
aacactgcttttaatttaccaaaagctgatagaaccaagttacttaaccaagttaacact
gcaattatttaa

DBGET integrated database retrieval system