KEGG   Mycoplasma genitalium M6320: CM1_01280Help
Entry
CM1_01280         CDS       T02211                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mgx01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgx01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgx00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mgx00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mgx00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mgx00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mgx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
254430..255401
Genome map
AA seq 323 aa AA seqDB search
MDKIAILTSGGDASGMNATIAYLTKYAIAKQLEVFYVKNGYYGLYHNHFITSKELDLTDF
FFMGGTVIGSSRFKQFQDPSLRKQAVLNLKKRGINNLVVIGGDGSYMGAKALSELGLNCF
CLPGTIDNDVNSSEFTIGFWTALEAIRVNVEAIYHTTKSHNRLAIIEVMGRDCSDLTIFG
GLATNASFVVTSKNSLDLNGFEKAVRKVLQFQNYCVVLVSENIYGKNGLPSLEMVKEHFE
NNAIKCNLVSLGHTQRGFSPNSIELFQISLMAKHTIDLVVNNANSQVIGMKNNQAVNYDF
NTAFNLPKADRTKLLNQVNTAII
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatagctattttaacttcgggtggtgatgctagtgggatgaatgccaccatc
gcttatctaaccaaatatgcaattgcaaagcaattggaagttttttatgtaaaaaacggt
tattatggcttgtatcacaaccattttatcaccagtaaggaacttgatttaactgacttt
ttctttatggggggaacagtaataggatcaagtcgtttcaaacagtttcaagatcctagc
ttacgaaaacaagcagttttaaacctcaaaaaacgtggtattaacaaccttgttgttatt
ggtggggatgggagttatatgggtgctaaagcactcagtgaattaggattaaactgcttt
tgtttacctggtacgatcgacaatgatgtcaattccagtgaatttaccattggtttttga
actgctttagaagcaattcgggttaatgttgaagcaatttatcacaccaccaaatcccat
aaccgcttagcaatcatagaagtgatggggcgtgattgtagtgatctgaccatctttggg
gggttagctactaatgctagttttgttgttactagcaaaaatagcttggatctcaatggc
tttgaaaaagcagtgagaaaggtgttgcaattccagaactattgtgttgttttggttagt
gaaaacatctatggtaagaacggtttacctagtttagaaatggttaaagagcactttgaa
aacaacgcaattaagtgtaacctagtttcactaggacacacccaaaggggctttagtcct
aatagtatcgaactctttcagattagtttaatggctaaacacacgattgatctggttgta
aataatgccaacagtcaagtaatagggatgaaaaacaaccaagcagttaactatgatttt
aacactgcttttaatttaccaaaagctgatagaaccaagttacttaaccaagttaacact
gcaattatttaa

DBGET integrated database retrieval system