KEGG   Mycoplasma genitalium M6320: CM1_01365Help
Entry
CM1_01365         CDS       T02211                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CM1_01365
   00670 One carbon pool by folate
    CM1_01365
Enzymes [BR:mgx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CM1_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
274459..274941
Genome map
AA seq 160 aa AA seqDB search
MLIAIWAMTQEGLIGNNNTLPWMIKQELAHFKKTTLFQALLMGRKTYESLPKVFEKRTIF
LLSKDQNYRFEEKGSEVKVINDFWPLIKSYQANKEKDLFICGGKSVYEQTINECDQLIVS
IIKKKYKGDQFLKVDLSKFVLNEVVEFEEFNVNYYRKKQQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgctaattgctatctgagcgatgacacaagaaggactaataggtaataacaacacttta
ccttggatgattaaacaagagctagctcactttaaaaaaactacgttatttcaagctttg
ttaatggggagaaaaacttacgaatcactccccaaggtatttgaaaaaagaacaatattt
ctcctttcaaaagatcaaaactaccgttttgaagaaaagggaagtgaagtgaaagttatt
aatgatttttgaccactaattaaaagttaccaagcaaataaagaaaaggatttgtttatt
tgtggtggaaaaagtgtgtatgaacagaccattaatgaatgtgatcagttaattgtttca
atcattaaaaagaagtataagggtgatcagtttttgaaggttgatctcagtaaatttgta
cttaatgaagttgtagagtttgaggaatttaatgttaattattatagaaagaaacaacaa
taa

DBGET integrated database retrieval system