KEGG   Mycoplasma genitalium M6320: CM1_01645Help
Entry
CM1_01645         CDS       T02211                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
mgx00010  Glycolysis / Gluconeogenesis
mgx00020  Citrate cycle (TCA cycle)
mgx00620  Pyruvate metabolism
mgx01100  Metabolic pathways
mgx01110  Biosynthesis of secondary metabolites
mgx01120  Microbial metabolism in diverse environments
mgx01130  Biosynthesis of antibiotics
mgx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mgx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CM1_01645
   00020 Citrate cycle (TCA cycle)
    CM1_01645
   00620 Pyruvate metabolism
    CM1_01645
Enzymes [BR:mgx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CM1_01645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-ProteinID: AFQ04097
Position
complement(329619..330773)
Genome map
AA seq 384 aa AA seqDB search
MANEFKFTDVGEGLHEGKVTEILKQVGDQIKIDEALFVVETDKVTTELPSPFAGTISAIN
VKVGDVVSIGQVMAVIGEKTSTPLVEPKPQPTEEVAKVKEAGASVVGEIKVSDNLFPIFG
VKPHATPAVKDTKVASSTNITVETTQKPESKTEQKTIAISTMRKAIAEAMTKSHAIIPTT
VLTFYVNATKLKQYRESVNGYALSKYSMKISYFAFFVKAIVNALKKFPVFNASYDPDQNE
IVLNDDINVGIAVDTEEGLIVPNIKQAQTKSVVEIAQAIVDLANKARTKKIKLTDLNKGT
ISVTNFGSLGAAVGTPIIKYPEMCIVATGNLEERIVKVENGIAVHTILPLTIAADHRWVD
GADVGRFGKEIAKQIEELIDLTVA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagtttaaattcactgatgttggtgagggtttacatgaaggaaaagtaact
gaaatcttaaaacaagttggtgatcagatcaagatagatgaagctttatttgttgttgaa
actgataaagttacaactgaactaccttctccttttgcaggtacaattagtgctattaat
gttaaagttggtgatgttgttagcattggtcaggtgatggcagttattggtgaaaagact
agtacaccacttgttgaaccaaaacctcaaccaactgaagaagtagctaaggtaaaagaa
gcgggggcttcagtagtaggggaaattaaggtttctgataacctctttcctatctttgga
gtaaaacctcatgcaactccagctgttaaagacactaaagttgcaagtagtactaacatt
actgtagaaacaacccaaaaaccagaaagtaaaactgaacagaaaaccattgctatctca
acaatgcgtaaagcgattgcagaagcaatgacaaagtcgcacgcaattatcccaaccact
gtattaactttttatgttaatgcaaccaagttaaaacaatatcgtgaaagtgttaatggt
tatgctttaagtaagtattccatgaaaatttcttactttgctttctttgttaaagcaatt
gttaatgcgcttaagaagttccctgtttttaacgctagttatgatcctgatcaaaacgaa
attgttttaaatgatgacattaatgtaggaattgctgttgatactgaagaaggtttaatt
gtccctaacattaagcaagcccaaaccaaatctgtggttgaaattgcccaagcaattgtt
gatttagctaacaaagctagaacaaaaaagattaagttgactgatttgaataaaggtact
atttcagttactaacttcggttcattaggagcagctgtaggtacacctattattaagtac
cctgagatgtgtattgttgctactggtaatttagaagaacgcattgttaaagtggaaaat
ggaattgcagttcataccatcttacctttaacaatagctgcagaccaccgctgggttgat
ggggcggatgttggtaggtttggtaaggagattgcaaaacaaattgaggaattaattgat
cttacagtagcttaa

DBGET integrated database retrieval system