KEGG   Mycoplasma genitalium M6320: CM1_01645Help
Entry
CM1_01645         CDS       T02211                                 

Definition
branched-chain alpha-keto acid dehydrogenase E2 subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mgx01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgx00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mgx00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgx00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(329619..330773)
Genome map
AA seq 384 aa AA seqDB search
MANEFKFTDVGEGLHEGKVTEILKQVGDQIKIDEALFVVETDKVTTELPSPFAGTISAIN
VKVGDVVSIGQVMAVIGEKTSTPLVEPKPQPTEEVAKVKEAGASVVGEIKVSDNLFPIFG
VKPHATPAVKDTKVASSTNITVETTQKPESKTEQKTIAISTMRKAIAEAMTKSHAIIPTT
VLTFYVNATKLKQYRESVNGYALSKYSMKISYFAFFVKAIVNALKKFPVFNASYDPDQNE
IVLNDDINVGIAVDTEEGLIVPNIKQAQTKSVVEIAQAIVDLANKARTKKIKLTDLNKGT
ISVTNFGSLGAAVGTPIIKYPEMCIVATGNLEERIVKVENGIAVHTILPLTIAADHRWVD
GADVGRFGKEIAKQIEELIDLTVA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgagtttaaattcactgatgttggtgagggtttacatgaaggaaaagtaact
gaaatcttaaaacaagttggtgatcagatcaagatagatgaagctttatttgttgttgaa
actgataaagttacaactgaactaccttctccttttgcaggtacaattagtgctattaat
gttaaagttggtgatgttgttagcattggtcaggtgatggcagttattggtgaaaagact
agtacaccacttgttgaaccaaaacctcaaccaactgaagaagtagctaaggtaaaagaa
gcgggggcttcagtagtaggggaaattaaggtttctgataacctctttcctatctttgga
gtaaaacctcatgcaactccagctgttaaagacactaaagttgcaagtagtactaacatt
actgtagaaacaacccaaaaaccagaaagtaaaactgaacagaaaaccattgctatctca
acaatgcgtaaagcgattgcagaagcaatgacaaagtcgcacgcaattatcccaaccact
gtattaactttttatgttaatgcaaccaagttaaaacaatatcgtgaaagtgttaatggt
tatgctttaagtaagtattccatgaaaatttcttactttgctttctttgttaaagcaatt
gttaatgcgcttaagaagttccctgtttttaacgctagttatgatcctgatcaaaacgaa
attgttttaaatgatgacattaatgtaggaattgctgttgatactgaagaaggtttaatt
gtccctaacattaagcaagcccaaaccaaatctgtggttgaaattgcccaagcaattgtt
gatttagctaacaaagctagaacaaaaaagattaagttgactgatttgaataaaggtact
atttcagttactaacttcggttcattaggagcagctgtaggtacacctattattaagtac
cctgagatgtgtattgttgctactggtaatttagaagaacgcattgttaaagtggaaaat
ggaattgcagttcataccatcttacctttaacaatagctgcagaccaccgctgggttgat
ggggcggatgttggtaggtttggtaaggagattgcaaaacaaattgaggaattaattgat
cttacagtagcttaa

DBGET integrated database retrieval system