KEGG   Mycoplasma genitalium M6320: CM1_02705Help
Entry
CM1_02705         CDS       T02211                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mgx  Mycoplasma genitalium M6320
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mgx00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mgx00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mgx00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mgx00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556160..557038
Genome map
AA seq 292 aa AA seqDB search
MKTKIRKAVIPAAGLGVRLLPATKAIPKEMLPLVNKPTIQYIVEEAVKSGIEQILVIVSS
KKTAILDHFDYDLILENALIQKNKLQEHKEIEDIANLAHIFFVRQKNQDGLGDAILFAES
FVGNEDFAVLLGDDVVFSKEPALKQCLEAYYETNCQTIGVQEVDPCHVDKYGIITPEGDY
KNKDLIKVLAMTEKPKPKDAKSNLAILGRYVLKPSIFKALRSVPYGVGGELQLTDGLNFC
LKNENFYVRKFTGTRFDVGTKSGFIKANLFTALNNKDISKKEVLELLNLVKA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaaataagaaaagcagttattcctgctgctgggttgggtgttaggttacta
ccagcaacaaaagcaattcccaaagagatgttaccattggtaaataaacctactatccaa
tacatagtagaggaagcagttaaaagtggcattgaacagattcttgtcattgtttcatcc
aaaaaaacagctatattagatcattttgattatgatctgatcttagaaaatgccttaatt
caaaaaaataaattgcaggagcataaagagattgaagatattgctaatttagcacatatc
ttttttgttagacaaaaaaatcaagatggtttgggagatgcaatcttgtttgctgaatct
tttgttggtaatgaagactttgcagtattgttaggtgatgatgttgtttttagtaaagaa
cctgctttaaaacaatgcttggaagcttattatgaaactaattgtcaaacaatcggtgta
caagaagtagatccttgtcatgttgataagtatggaattatcacccctgaaggtgattac
aaaaataaagatcttattaaggttttagcaatgactgaaaaacctaaaccaaaagatgct
aaaagtaatttagcaatcttagggcgatatgtactcaaaccatctattttcaaagcactt
agaagtgtaccttatggagttggtggtgagttgcagctaactgatggtttaaatttttgt
ttgaaaaatgaaaacttttatgtaagaaagtttactggtactaggtttgatgttggcaca
aagagtggttttattaaagcaaatttatttactgctttaaacaataaagatattagtaaa
aaagaagttttagaacttttaaatttagttaaagcttaa

DBGET integrated database retrieval system