KEGG   Magnetospirillum gryphiswaldense: MGMSR_0815Help
Entry
MGMSR_0815        CDS       T02960                                 

Gene name
cbbM
Definition
Ribulose bisphosphate carboxylase (EC:4.1.1.39)
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mgy  Magnetospirillum gryphiswaldense
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mgy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGMSR_0815 (cbbM)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MGMSR_0815 (cbbM)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MGMSR_0815 (cbbM)
Enzymes [BR:mgy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MGMSR_0815 (cbbM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(847108..848493)
Genome map
AA seq 461 aa AA seqDB search
MDQSKRYCNLALNEAELMAQGRHVLCAYIFKPKAGYEPIATAAHFAAESSTGTNVEVCTT
DDFTRGVDALVYEVTEQANGDHLMKIAYPNDLFDRNLIDGRAMIVSFLTLTIGNNQGMSD
VEYAKMHDFWVPPAMLQLFDGPAMNIADMWRVLGRPQVNGGMVVGTIIKPKLGLRPKPFA
DACHQFWLGGDFIKNDEPQGNQVFAPMREVIPLVADALRRAQDETGEAKLFSANITADDP
FEMIKRGEMILETFGENANRVAFLVDGYVGGPSAITLARRYFPNQFLHYHRAGHGAVTSK
QSKRGYSVLTHMKMARLQGASGIHTGTMGYGKMEGDKDEKMVAYMLERDVADGLYFRQDW
QGIKATTPIISGGMNALRLPGFFDNLGHSNVIQTSGGGAFGHKAGGTVGAKSLRLAHEAW
VRGINLVDFAQEHPELKGAFESFPQDADALYPGWRDKLKVR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtccaagcgctattgcaacctggcccttaacgaagccgagctgatggcccag
ggccgtcatgtcttgtgcgcctatatcttcaagcccaaggccggctacgaacccatcgcc
accgccgcccatttcgccgccgaatcctcgaccggcaccaatgtggaggtgtgcaccacc
gacgatttcacccgcggcgtcgacgccctggtctatgaggtgaccgagcaggcgaacggc
gatcatctgatgaagatcgcctatcccaacgacctgttcgaccgcaacctgatcgacggt
cgggccatgatcgtgtcgttcctgaccctgaccatcggcaacaaccagggcatgagcgac
gtcgaatacgccaagatgcacgatttctgggtgccgccggccatgctgcaattgttcgac
ggcccggccatgaacatcgccgatatgtggcgggtgttgggccgtccccaggtcaatggc
ggcatggtggtcggcaccatcatcaagcccaagctgggcctgcggcccaagccgttcgcc
gatgcctgccatcagttctggctgggcggcgacttcatcaagaacgacgagccccagggc
aatcaggtcttcgcccccatgcgcgaagtgatcccgctggtggccgacgccctgcgccgg
gcccaggacgaaaccggcgaggccaagctgttttccgccaacatcaccgccgatgacccg
ttcgagatgatcaagcgcggcgagatgatcctggaaaccttcggcgaaaacgccaaccgc
gtcgccttcctggtcgatggctatgtgggcggcccctccgccatcaccctggcccgacgc
tatttccccaatcagttcctgcattaccaccgtgccggccacggcgccgtcacctcgaaa
cagtccaagcgcggctattcggtgctgacccacatgaagatggcccgcctgcaaggggcg
tcgggcatccataccggcaccatgggctatggcaagatggaaggcgacaaggacgagaag
atggtcgcctacatgctggaacgcgatgtcgccgacggcctgtacttccgccaggactgg
cagggcatcaaggcgacgacgccgatcatctcgggcggcatgaatgctttgcggctgccc
ggctttttcgacaatctgggccattccaacgtcatccagacctcgggcggcggcgccttc
ggccacaaggccggcggcacggtgggggcgaaatccctgcgcctggcgcacgaagcctgg
gtgcgcggcatcaatctggtggatttcgcccaggaacaccccgagttgaaaggcgccttt
gaaagcttcccccaggatgccgacgcgctgtatccgggctggcgcgacaaactgaaggtg
cgctag

DBGET integrated database retrieval system